SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NDI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NDI1
Domain Number 1 Region: 373-481
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-26
Family SH2 domain 0.00000139
Further Details:      
 
Domain Number 2 Region: 485-526
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000115
Family SOCS box-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3NDI1
Sequence length 540
Comment (tr|G3NDI1|G3NDI1_GASAC) Suppressor of cytokine signaling 5 {ECO:0000313|Ensembl:ENSGACP00000003381} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=socs5 OC=Gasterosteus.
Sequence
MKKVGNMWNNLKSKCQTLFHNGSGPSESRAEADGVHCVVDLGLGGSSGDAQASRASSPSR
SLLPVPMAPVGRRHHNCVSDVPQIVEITIDKDTEDVRGGSGGTPMARRDSYSRHAPWGGK
KKHSFSTKTQSSLEAERRPGRLRGAGNRRDRRYGVGSIQEMCDSVSGGRSLNARSLRQRL
SDTVGLCLPLPARRRSRSSKNPVASKRKIHLTELMLETCPFPPGSDLANKWHLIKQHTAP
VSPHSSTALLDAFDPAHPSPEDEEERLRERRRLSIEEGVDPPPNAQIHTLEASVPGSSLY
KLGPKLGPGTGEASGEGRASGSSDCDSEEDTTTLCLQARRPKQRHASGDVQLSRQQPGPW
KVHTQIDYIHCLVPDLLQITALPCYWGVMDRYEAEALLDGRPEGTFLLRDSAQEDYLFSV
SFRRYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSACMFFEPLLTAPLH
RTFPFGLQHLARAAICRWTTYDGIGSLPLPPALQDFLKEYHYKQKVRVRWLEREPPLKVK
Download sequence
Identical sequences G3NDI1
ENSGACP00000003381 ENSGACP00000003381 69293.ENSGACP00000003381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]