SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NDK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NDK2
Domain Number 1 Region: 1617-1740,1768-1805,1840-1921
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-32
Family Tandem AAA-ATPase domain 0.021
Further Details:      
 
Domain Number 2 Region: 1299-1346,1462-1666
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-22
Family Tandem AAA-ATPase domain 0.03
Further Details:      
 
Domain Number 3 Region: 1952-2171
Classification Level Classification E-value
Superfamily DNase I-like 1.11e-17
Family DNase I-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3NDK2
Sequence length 2173
Comment (tr|G3NDK2|G3NDK2_GASAC) ATP-dependent DNA helicase {ECO:0000256|RuleBase:RU363044} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
ALLLMRLLCIAVFRTKSGRYGFFDPHSRTARGLPLPAGSRTPGTAVMVTFSRLSDMIDRL
KKSHRMMDTQSSCNYELKPVEFYNVNTDPSDDILTAESSDIIFTSSVRQQEIINSNETEL
SSQSTFLPSHDASLNEPSMSSSVENTVASDLSDVLLQGIPCKLTKCDKNKRRKIKRRLMV
SERNQQRQEIKKSKEREKYASNKAYKAQKKSHARMQYQNNPEFRQKKINNTKDNVDFQQK
RKEYITSQYRENAEFREKQKQILVSRYRNNAEFREKQKQILVSRYRNNPDFREKQKEILV
SRYRNNPEFREKQKEILVSRYRNNPEFREKQKQHFTDRYRDNAEFRKEKKLYFTAFYKNS
IDFRERKRSHIIQRYAHDQAFRLRHKQLMKQRMKDRYKNNPTYKSMRNMRCAMKIKRKYR
GINNPTEESDNSLIKEAISVFRSQIKSGPTYVCTVCHKASFPNQVKPCKRLNYVRNPDVV
AACLTGKYVHVCDDQCRDEQQCNVPDERKEEWICHTCHNHLKDGVMPTLAVANNLELADI
PPELCDLNILERHLIAKCIAFAKIVPLPKGRQRAIHGNVVCVPSEVQETVEALPRLRSES
QVMRVKLKRRLCYRGHQLFQTVTWSKLVQALHKLKRIHPQYQDITIRDEAELCDPTLLKE
IDMCEDVDMLSCDGEQPEQQRDDEEQEGEMPNGGFALESCLQPCDVSEEILCFSEGIYSV
APAESNSPVGFFKTPKLEAMAFPVQFPTGQNTLDEGRRMKVTPSSYFKARLFCVDDRFAR
DTNYLFFAQFVTEIHLATSSMTIQLRKGKPMTRDGRKITSGMLQNKREVEKLVRNKDAVR
FMQPLRGTPAYWEKTTRDLFAMIRQLGTPTFFCTFSAAEMRWPEVIEAIKRQQGEEVNFE
GLDWSAKCDILRSNPVTTMRMFDKRVEALFRDVLLSPAQPLGKVVDYFYRVEFQHRGSPH
IHCLIWVEGAPVFEEDDDHTVSAFVSKYITAQLPDQLTQPELYKKVTEVQIHSKKHSRTC
FRSPSSGCRFGFPKPPSRKTMISRPGEGVAPLQLQIAKSKLQPLNLLLNEPETASLSLQQ
LLVKCNLTLQEYEGCLNVINKSSAVILKREPKDCWVNGYNAHLLEAWDANIDVSYILNAY
SCIMYLTSYITKKESGLSEYLKTVIENSTRDHVNECDEMREIMQAYSKKREVSAQECVTR
ACGINMKKCSRGVIFVPTDDNALKMSRPMSYLENTTLESVNVWMTSLTDKYKSRPETPEF
EQMCLADFAATCRIVYGQQKKGKDVLPLLNDMGFVQKRKNDKPAIIRFYRCSQEKYPEKF
YGTLLKLYIPHRSDLELKRRHFPTYESFYKSGCVQLPGSDHPEYVRHIVKRNKDKYEKNS
EDIENAVEEFEQNRGVIDEWCNLAPESEVERLECIEELEAREPDHENVQENVPEYTNQAN
AATEARAIREPPAFDPTVLRQMYQNLNQKQACVFYAVRDWCVKRVCGLNPEQFFFYVNGG
AGTGKSHLIKCIYSEASKILCKLPSHSEEVDISNPTVLLTAFTGTAAFNISGSTLHSLLK
LPRSLKPPFQGLGNQLDEVRSELLNAEILVIDEVSMVSKPLFAYVDARLKQIKGSTKPFG
GMSVIAVGDFYQLPPVRQSKTLCVYEPCEIDLWQEHFQTITLTEIMRQKDDVAFAEMLNR
IRVKGKSDELSQADRALLSQTITEPSLCPPDVLHIFATNKQVDSHNSVTLALLHSNITKI
DADDYKKDPRTGRMARQAQPYKGNRNELPDTLNVAEGARVMLTRNIDVSQGLVNGSFATL
VRVITAEQSGVAHVTMLGLKMDDQTAGRNYRNRAPGGPDDVVYIERAEDNLKQKGVVRRQ
FPVRLAFACTIHKVQGMTRTSAVVSLKHIFEPGMAYVAISRVTSLSGLHMLDLDESKIYA
NPEITGALETMRQVNLDDVMPLLRITQTSSRHDTLTIVHHNTEGLPSHINDIRHHELCLA
DVLCLTEHLQGSFVAESLHLEGYNMFKRNRHLSYTNIPQIANRGGGGVAVYVKSHIQVRE
KQYVHNVTDLEFVALKVEAPVRALIAAVYRPPDYSVRSFLSNLGSLLDSLEIMDCQPIIV
CGDFNENLFSNTGKPILELFQSRGFAQVITAATTDKNTLLDLIFISQPQRCLQSGVMRTY
YSYHNPVYCVMSF
Download sequence
Identical sequences G3NDK2
ENSGACP00000003402 69293.ENSGACP00000003402 ENSGACP00000003402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]