SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NDL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NDL7
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily EF-hand 5.81e-57
Family Calmodulin-like 0.00000082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3NDL7
Sequence length 151
Comment (tr|G3NDL7|G3NDL7_GASAC) Calmodulin 3b (phosphorylase kinase, delta) {ECO:0000313|Ensembl:ENSGACP00000003417} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MADQLTEEQIAETEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA
DGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLT
DEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Download sequence
Identical sequences G3NDL7
ENSGACP00000003417 69293.ENSGACP00000003417 ENSGMOP00000007316 ENSGACP00000003417 ENSGMOP00000007316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]