SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NG63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NG63
Domain Number 1 Region: 359-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-63
Family SPRY domain 0.00000381
Further Details:      
 
Domain Number 2 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.27e-17
Family B-box zinc-binding domain 0.00051
Further Details:      
 
Domain Number 3 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 4.42e-16
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Weak hits

Sequence:  G3NG63
Domain Number - Region: 275-313
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0245
Family Arc/Mnt-like phage repressors 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3NG63
Sequence length 543
Comment (tr|G3NG63|G3NG63_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000004318} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MASANYGPSEAQFLCSICLDVFTDPVSTPRGRNFCINCINEHWNTSDQNLCPTCKKNFIT
RPNLRVNTMFSEMVVKFRESAQQKASSSSSEQQESKPREVPCDVCTGTKMKALKSCLVCL
VSYCETHLEPHLTMSGLKRHQLMDPVENLKGRMCKKHDKPLELFCKSDRTCVCMLCSVLD
HKMHDVVPVEEEYEEKKVELKKTEAEIQQMIQKRRVKIQEIKHSVDLSEEDAGREKAEGV
QVFNDLMESVGRGLKELLKTIEEKQETTKKQAEAFIRELEEEISELMKRSAEVEQLSLSE
DHLHLLQSSNIHQPPPTKDWTEVSVCPSSYEGTVVRAVSQLEETLSKKMKKWFAELMKVQ
MFSVDLTLDPQTAHPNLILSDDGKQVKHGNVWKKLPNNPERFYYWLCVSTKQSFSSGKFY
FEVQVEGKTEWYLGVARKSVDRKGHISLSPQKGYWTIWLRNKYNASADPSVVLSLKSRPQ
KVGVFVNYEEGVVSFYDVEAAALIYSFTGCSFTEKLFPFFNPGDNKNGGNSAPLIISPVR
SSE
Download sequence
Identical sequences G3NG63
ENSGACP00000004318 ENSGACP00000004318 69293.ENSGACP00000004318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]