SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NHJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NHJ1
Domain Number 1 Region: 31-95
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000263
Family Ovomucoid domain III-like 0.0066
Further Details:      
 
Domain Number 2 Region: 143-219
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000147
Family Calmodulin-like 0.068
Further Details:      
 
Domain Number 3 Region: 225-266
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000429
Family VWC domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3NHJ1
Sequence length 310
Comment (tr|G3NHJ1|G3NHJ1_GASAC) Follistatin-like 1b {ECO:0000313|Ensembl:ENSGACP00000004800} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
VWSQESSFSLIHIPNLGLQELQSKSKVCANVFCGAGRECTVTEKGEPSCLCIESCKPHKR
SVCGSNGKTYRNHCELHRDACLTGLKIQVAHDGHCHEKKTDQSAASPVVCYSADRNELRS
RVIQWLQTEVVPDGWFVKGSNFSDILLKYFKSYDNGDSQLDSSELLKFIQQNDSVVELQS
YADKESNKLLKSLCVDALIELSDENADWKLSFDEFLNCLKPGFNPPEKKCALEDETYEDG
AETQVECNRCVCACGNWVCTAMTCTDKAAAVDETADAGAEMTEEEWSLRVAELNKHQETV
EKMKSSTKEA
Download sequence
Identical sequences G3NHJ1
ENSGACP00000004800 ENSGACP00000004800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]