SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NHK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NHK8
Domain Number 1 Region: 280-418
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000424
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 450-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 419-460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000683
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 189-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000479
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 5 Region: 157-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000102
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  G3NHK8
Domain Number - Region: 496-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000113
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 238-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000316
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3NHK8
Sequence length 679
Comment (tr|G3NHK8|G3NHK8_GASAC) Fibulin-1 {ECO:0000256|PIRNR:PIRNR036313} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=FBLN1 OC=Gasterosteus.
Sequence
MGPCALLLCSVFGLLLGQGAGQISTEDCCKDGRKRGNDNQDCASLPLISESITCRIVQEQ
CCVTVLQDNMCNTGINVAKDQGACDALFTNTCETKTTKMCCDCCLLGMATQAKNLPCDHD
LSVGYQCSLVSRACCSDGAPVANDENTSNGDSQLRDQCKGKCAHECVGNGTCTCFKGYKL
KPDAKSCEDINECLLGASNCRGGERCINTQGSFRCQREVSCGTGYELTDDNNCKDIDECE
TDIHNCGPGLECQNTQGSFRCPPKVKCGSGFIQDALGNCIDINECISQTGPCHRGQICIN
TVGSYSCQRNSVNCGRGYHLNEEGTRCVDIDECKGPEKVCAGHGCINLIGSYRCECEAGY
VFNSITRLCEDINECRHYPGRLCAHKCDNILGSYKCSCTTGFKLAADNRNCDDLNECESN
PCSQECANVYGSYQCYCRRGYQLSDMDGMTCEDIDECALPTGGHICSYRCLNTPGSFHCS
CPVSGYTVAPNGRSCQDVDECVAGTHTCTVNQSCFNVQGGFRCLSFDCPNNYRHVGETVA
RLQRSDTIRCMKSCQPNDIACVLDPMHSVSHTFISLPTFREFTRPEEIVFLRTTVPAYGS
YHLGSYDVKFDILEGNVDDAFDVIKRVENGLFVGVVRQVKSVIGPLAAVLKLSMRNLTTQ
GDSGQNIINVHVFVSEFWF
Download sequence
Identical sequences G3NHK8
ENSGACP00000004817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]