SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NIB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NIB0
Domain Number 1 Region: 6-212
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-49
Family Ankyrin repeat 0.000074
Further Details:      
 
Domain Number 2 Region: 225-265
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000209
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3NIB0
Sequence length 274
Comment (tr|G3NIB0|G3NIB0_GASAC) Ankyrin repeat and SOCS box containing 9 {ECO:0000313|Ensembl:ENSGACP00000005070} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=ASB9 OC=Gasterosteus.
Sequence
MSDLESDWSPIHEAAFNGRVLTLQRLIAQGTCVNLNTLDQVSPLHGACLQGHVACATLLM
ENAANVNGSTVDGQTPLSEACARGHVTCVSLLLHHGATPLGSTPTSSPIHRAAAKGHPEC
IQPLVEHGADVDQHIAQCGSPLSVACSNEHLSAVRKLLQLGASVNGAVSGDSPLHIAAGL
SNPELVSVLLDHGADRGLRNSEGKQPADLAPPNSRAQRLLRQAGGASPLMQLCRLHIRRT
VGKQRLGGIQDLPLPTEVKQYLLYQSDPAGEPAH
Download sequence
Identical sequences G3NIB0
ENSGACP00000005070 ENSGACP00000005070 69293.ENSGACP00000005070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]