SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NIC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NIC0
Domain Number 1 Region: 172-241
Classification Level Classification E-value
Superfamily Homeodomain-like 5.99e-18
Family Homeodomain 0.0000577
Further Details:      
 
Domain Number 2 Region: 44-111
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000793
Family LIM domain 0.03
Further Details:      
 
Domain Number 3 Region: 14-42
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000117
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  G3NIC0
Domain Number - Region: 108-135
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00104
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3NIC0
Sequence length 351
Comment (tr|G3NIC0|G3NIC0_GASAC) ISL LIM homeobox 1 {ECO:0000313|Ensembl:ENSGACP00000005080} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECSQYLDESCTCFV
RDGKTYCKRDYISRLYGIKCAKCNIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDE
FALREDGLFCRADHDVVERASLGSGGDPLSPLHPSRPLQMAAEPISARQPALRPHVHKQP
EKTTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKK
RSILMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFA
LQSDIDQPAFQQLVSFSEGGPGSNSTGSEVASMSSQLPDTPNSMVSSPIEA
Download sequence
Identical sequences G3NIC0
ENSGACP00000005080 69293.ENSGACP00000005080 ENSGACP00000005080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]