SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NIS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NIS2
Domain Number 1 Region: 166-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 2 Region: 47-205
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000942
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 3 Region: 211-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000301
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3NIS2
Sequence length 321
Comment (tr|G3NIS2|G3NIS2_GASAC) EGF-like-domain, multiple 6 {ECO:0000313|Ensembl:ENSGACP00000005232} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MQLLTLHLAALYFIVHISSASGGAHRPSRQVLTGNQPGVCRYGRRLECCYGWKKNSKGQC
EAQCDHGCKHGECVGPNKCKCFPGHSGKTCNQDLNECGLKPRPCEHRCMNTYGSYKCYCL
NGYTVMPDGSCANSRTCSAAHCQYGCEEVQEEIRCLCPSAGLQLGQDRRTCIDIDECVTG
NNLCPYNRQCVNTFGSYFCKCRSGYDLKYVEGKYDCVDLDECASSTHKCSHHAVCANTRG
SYKCSCKSGFRGNGFECSVIQDSQVKPGILGGTLDNDDIKNIITEPVATPAPNIHQQPFD
YDGEVYIGPGTDQGQAGEEGR
Download sequence
Identical sequences G3NIS2
ENSGACP00000005232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]