SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NIT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NIT5
Domain Number 1 Region: 649-807
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-42
Family MAM domain 0.00081
Further Details:      
 
Domain Number 2 Region: 248-417
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-40
Family MAM domain 0.0016
Further Details:      
 
Domain Number 3 Region: 810-965
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-34
Family MAM domain 0.00067
Further Details:      
 
Domain Number 4 Region: 477-634
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-31
Family MAM domain 0.0015
Further Details:      
 
Domain Number 5 Region: 974-1136
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-30
Family MAM domain 0.0031
Further Details:      
 
Domain Number 6 Region: 37-200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-27
Family MAM domain 0.0028
Further Details:      
 
Domain Number 7 Region: 437-477
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 209-245
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000681
Family LDL receptor-like module 0.0027
Further Details:      
 
Weak hits

Sequence:  G3NIT5
Domain Number - Region: 3-23
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00196
Family LDL receptor-like module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3NIT5
Sequence length 1137
Comment (tr|G3NIT5|G3NIT5_GASAC) MAM and LDL receptor class A domain containing 1 {ECO:0000313|Ensembl:ENSGACP00000005245} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
PEDRVCDFTDNCGDGSDEEDCEYKGRSASTTPHLPASRCDFEGGSCGWYELTLGDGFDWV
RGGSVEVPPDSHPPPLDHSTNSTEVIAGHFMFILKNSSSLHPTAVLRGPWFKQSASGCTI
TFWHYNSGMSVGAADMYLQMNGVKNRTVIWRTLYDQGTRWNRVTVQLGRLTRPFHIALAK
ISLGVFNGVSALDDITFENCSMPPAAAECPTHTHFHCVHSKACVEHLQLCDLVDDCGDGS
DEEGCSPELQCNFERGLCGWRQEVSGGDVFDWTRVQGPTPTINTGPLKDHTLGTSLGHYL
YIESSAPQEFKDTAVLLSRVFQPTRQRGENAPDQHCVFRFHYHMYGSHVFCLAVYLRTAA
SSRGSMLWVRYGAQGNLWHRKTLYLASARPFQILIEGTVGDDFNGDIAIDDLSFLHCGEL
PAVNTTTPAVTTPAPTLPPHSCPDGEFACGAHGECVADGKVCDFRRDCSDGSDEESCVEE
RCDFEGGNTCGWNSADSPLVPMHAFRWSPDQVASVFSPYRGGAEGWYMCADSSNGGYGQT
ADLQSPAVASTGPQCTLVFWYHMSGFTVGSLHVLLKYGNVTHEVWSQTGNQGNKWRRGEV
FLGLLKNFQVVFRAKRGISYMGDVVIDDVAFVHCAPPLPSDRPCTLGFSGRCSFEFDLCS
WRQCLRDDFDWLIKAGSTPTVGTGPSSDHTLRDPSGHYLYLESSFPQAAGDAARISGPLL
SRRSSQCKMRFYFHMSGDGIGTLSVFSRSGGHLRLLWNLTGDQGNYWQMREIPLSHDRDF
QVVFEGKVGRSAKGDICVDDITFSAGCMLSSSCSFESGRCGWTSSLADSFDWTLGTGSVK
GIRPPYDHTSMDESGHFVFLEATPVGLKGDKAHIRSSVWKESSAICKLSFWYYISHKASG
TIRLLIKTESRLWEAWNKTGHQGNEWNRAEIPLRKLRNFEVIFEGIRSSDVSGGAALDDL
QFEDCAPKRVFDLPGACNFNAGERRWEDACQLSQGADDDFDWTIGYRTQTPGAGPEADHS
PGCGGGSFLYIHTANQREGDVAKVTTRNAFPASIGRCDLRFWFYMHGSDRMGTLKVFTVG
PSGTSLLMWAATGNHGNQWKYANVILSNPGPFRVTFQAEAGGDMWTDIALDDISYTA
Download sequence
Identical sequences G3NIT5
69293.ENSGACP00000005245 ENSGACP00000005245 ENSGACP00000005245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]