SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NIU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NIU8
Domain Number 1 Region: 508-647
Classification Level Classification E-value
Superfamily FAS1 domain 5.1e-27
Family FAS1 domain 0.0026
Further Details:      
 
Domain Number 2 Region: 325-491
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000314
Family FAS1 domain 0.0066
Further Details:      
 
Weak hits

Sequence:  G3NIU8
Domain Number - Region: 225-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00359
Family EGF-like domain of nidogen-1 0.063
Further Details:      
 
Domain Number - Region: 107-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00691
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 265-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00698
Family Merozoite surface protein 1 (MSP-1) 0.036
Further Details:      
 
Domain Number - Region: 156-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3NIU8
Sequence length 668
Comment (tr|G3NIU8|G3NIU8_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000005258} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
TFDPRTDSVLLLCVIVLFFLHRGCSANLTARTGRCDISDRLDVHTSCSSCAAINRCPPGF
RSAGTANCSYVVEIGGREVVLDGCQHVCTKGFMKPQCCPQHWGPLCLSCPSWSGKPCSFH
GTCVDGDVGNGTCVCDDGFSGFACQECRDHNRFGEKCDKGVCSNGPEGDGQCLCQPPYSG
TRCDQVSTRCSSCSPNSYCRGDADAAGCECLPGYRRTAAGKCATGICAARDCDVNAQCSS
QGSRVTCACKPDYLGDGRVCVPRNPCSENNGGCPVNSTVCVFKGPNESQCRCMFGMSPVG
GSAAFGCELVSACSADTCDATAVCHTEADGQHRCVCEAGQIGDGHRCYGNLMERLIELDR
SGSQRESLTGSVAMFEKGCSLLLSHMGPFTAFVPVMKTPLSVGGHSNGVNDEQMCKNHLI
LGQHLFSDLEGRDVNLVGGAKWRSKGNKEAAVLFQMSHWFILMDNPSRPYTVIQEDLPAA
NGIIHVIDRPITTTLSDRSTRDEQFADKTIREILTKDPKYNRFLSLVDNCGSPPPFRGPG
PLTVFVPTNEAVDKSRDGSILYMLHEAKYKLQELLRHHVFSHAVLTVDELAALPQIQTMA
NQIVSISVSNDGEILLGEKGVRLASTNIVASNGIIHMIDGLLYPPSILPILPHRCDVINS
EVIVVSRA
Download sequence
Identical sequences G3NIU8
69293.ENSGACP00000005258 ENSGACP00000005258 ENSGACP00000005258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]