SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NJP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NJP2
Domain Number 1 Region: 143-259
Classification Level Classification E-value
Superfamily C-type lectin-like 5.74e-40
Family Link domain 0.0026
Further Details:      
 
Domain Number 2 Region: 670-816
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-38
Family C-type lectin domain 0.00000479
Further Details:      
 
Domain Number 3 Region: 259-350
Classification Level Classification E-value
Superfamily C-type lectin-like 1.07e-29
Family Link domain 0.0067
Further Details:      
 
Domain Number 4 Region: 39-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000106
Family V set domains (antibody variable domain-like) 0.041
Further Details:      
 
Domain Number 5 Region: 818-877
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000278
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3NJP2
Sequence length 877
Comment (tr|G3NJP2|G3NJP2_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000005554} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
YVRIFPLPLTVSVYANCAISKEQEGAFKNDVRQLQVKIPHSGPVSAPLGSSVSIPCLVYR
SSSSPVAPRVKWTVVSDGVETQILVARGERVKVNEAYRDRAAWLNYTSSPDDLSLWLGDL
RSSDSGHYRCEVQQGLEDASDLVQLKVKGVVFHYRDALGRYAFSFHRAQSACEAIGAQIA
TPDQLLAAYYDGYEQCDAGWLADQSVRYPIQVPREGCYGDMDGQPGVRNYGTMDQEDLYD
VYCYVEETDGEVFHDSVPQQLSFDEAQSYCRAAGAELATTAQLYLAWSEGLDRCSPGWLS
DGSVRYPIIAPRERCGGPQPGVKALYRFSNQTGFPHPSSLHDVYCFRHNRSSPTDFPMDN
GSTGQEDIRQDVVILMETDQELQINQHVEQGELKAQQVLESFPLFSSKENLQSEPEDLPQ
MQETNVDFNRSQADYQPDGNHTQEEGSSSLEIEDTVTLESKEKQPHPTMSEDNLVSAVSL
VTTESPEGSNASLLPTDSFKARYQTSEEASVAPTLKEGESSAPNLEEEPSFAPTLEKKKN
LVLPQPLKRKLLFPQPSKEANVAPSLKEEETSTPTLEEEANVAPSLKEEETSTPTLEEEA
NVAPSLKEEETSTPTLEEEAKVAPSLNLTQPPTTLILPNERAAVGGTWRASDACVIDPCH
NGGTCTDQNGQIQCLCLPSYAGDFCQTDLERCEPGWDKFHGFCYRHFSRRLSWEVAEQHC
RMLGAHLVSIITPEEQSYINNNYKEYQWTGLNDKTIEGDFRWSDGNVMLYENWYIGQPDS
YFLSGEDCVVMVWHDEGRWSDVPCNYHLAYTCKKGTSSCGPPPRVRNASIFGKGRQRYET
NAVVRYHCAQGFQQRLTPLIRCLSGGRWERPQVLCIP
Download sequence
Identical sequences G3NJP2
ENSGACP00000005554 ENSGACP00000005554 69293.ENSGACP00000005554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]