SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NL03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NL03
Domain Number 1 Region: 474-601
Classification Level Classification E-value
Superfamily TIMP-like 3.66e-22
Family Tissue inhibitor of metalloproteinases, TIMP 0.018
Further Details:      
 
Domain Number 2 Region: 243-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000809
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 3 Region: 308-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 4 Region: 371-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 5 Region: 58-138
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000136
Family APC10-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3NL03
Sequence length 602
Comment (tr|G3NL03|G3NL03_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000006016} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
LESRCSGRACNPRIGNLVHGRALRSQSVCGSNSSETYCAFKEVTSSRIRDSCSAVKCSKC
SSAVPDQAHPPSAMSDSSFRYPDTWWQSAEGAKEETLQLDLETEFLLTHLILVFRSPRPA
AMVLERSQDRGRTWKALRYFAGDCEGVFGLAEGSPVGESGATCTAKYSGASPCTRGEVIY
RALSPWNSVDPYGPAAQDQLMVTNLRVRLLQRQQCPCQAKHPGGAVLPTDHYAIYDFIVK
GSCLCNGHADHCVPAGGQQKANNMVHGKCVCRHNTAGEHCERCAPLYNDRPWQAANGIVG
TPHECQRCKCNGHAKSCHFSRGSWLASGRRSGGVCDSCHHNTEGRHCENCERGFFRDPDR
PKTAPDSCRACSCHPVGGVRSGGAPLCNPSSGECTCKPGVGGPRCESCMLGYWGLHEYGC
RPCDCTADCDPYTGDCISDSDVEVFHAATGHMGHRSSNRETALFRLQELFSALHHSEKCE
CVEVPLGSPKLFCAAEYDYVLVVKVVTAHDKGSHAEVEVKVKKVFYQNPQMKIQRGNVTL
YPESWTTNGCTCPILNPGSEYVVAGHEDRKTGQLMINAKSLIKSWKSTLGRKILHILRKD
CG
Download sequence
Identical sequences G3NL03
69293.ENSGACP00000006016 ENSGACP00000006016 ENSGACP00000006016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]