SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3NLC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NLC4
Domain Number 1 Region: 107-353
Classification Level Classification E-value
Superfamily DNase I-like 2.88e-32
Family DNase I-like 0.04
Further Details:      
 
Domain Number 2 Region: 19-59
Classification Level Classification E-value
Superfamily UBA-like 0.00000024
Family TAP-C domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3NLC4
Sequence length 355
Comment (tr|G3NLC4|G3NLC4_GASAC) Tyrosyl-DNA phosphodiesterase 2b {ECO:0000313|Ensembl:ENSGACP00000006137} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MASNGASDSDKPSVSNVERSRSRLCDEFASLTGSDSGVAQCYLAEHEWEMERALNSFFEA
DLEKVFEDDIPNSETSPPKKKQKVDIDLTGDSPASTRKPSDEDDNKLSLISWNVDGLDTD
NLGERARGLCSFLVLYTPDVVFLQELIPPYVQYLKKRAVSYLIIEGGEDGYFTGMMLKKT
RVRFLESEIVSYPTTQMMRNLLVAQVTFKDQKLCLMTSHLESCKGQAEERMKQLRVVTHR
MREAPDDVTVLFGGDTNLRDAEVAKVGLPSGVCDVWERLGKQEHCRYTWDTKANNNKKVP
YISRCRFDRVYLRPAAKDGVPRLAPDHMALVGLEKLDCGRYTSDHWGIYCSFSSA
Download sequence
Identical sequences G3NLC4
ENSGACP00000006137 69293.ENSGACP00000006137 ENSGACP00000006137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]