SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NLW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NLW2
Domain Number 1 Region: 1-452
Classification Level Classification E-value
Superfamily Sema domain 1.05e-122
Family Sema domain 0.0000304
Further Details:      
 
Domain Number 2 Region: 1304-1433,1654-1836
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.23e-49
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 813-912
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000237
Family Other IPT/TIG domains 0.0086
Further Details:      
 
Domain Number 4 Region: 997-1100
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000336
Family E-set domains of sugar-utilizing enzymes 0.086
Further Details:      
 
Domain Number 5 Region: 910-998
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000433
Family Other IPT/TIG domains 0.041
Further Details:      
 
Domain Number 6 Region: 455-506
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000663
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 756-790
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000051
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 8 Region: 1116-1188
Classification Level Classification E-value
Superfamily E set domains 0.0000482
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3NLW2
Sequence length 1843
Comment (tr|G3NLW2|G3NLW2_GASAC) Plexin A1a {ECO:0000313|Ensembl:ENSGACP00000006325} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
LTHLVVHNKTGEVYLGGVNWIYKLSKNLTKLRSHVTGPVTDNPRCYPPPGVQSCPHELVQ
TSNVNKLLLLDAAHNRLIACGSTSQGICQFLRLDDLFKLGEPHHRKEHYLSSVAEAGTMS
GVVISPDLFGGGGKLFVGTPIDGKSEYFPTLSSRKLMSNEENADMFSFVYQDEFVSSQLK
IPSDTLSKFPAFDIYYIYGFNSEQFVYYLTLQLDTQLTSPDASSEQFFTSKIVRLCVDDP
KFYSYVEFPIGCTKDGVEYRLVQDAYSLGIQEHEEVLFTVFAQGQKNRAKPPKESALCLF
TMRRIKERIKERIQSCYRGEGKLSLPWLLNKELACINSPLQIDDNFCGQDFNQPLGGTTA
IEGIPLYVDKDDGMTSVTAYDYRGHTVAFTGTRGGRIKKVGVDLGAPTQFLLQYYENVVV
SDGSPILRDMLFSPDHQNLYALTDKQVTRVPVESCEQYSNCGACLGSGDPHCGWCVLHNV
CARKDRCERAEEPQRFTTRAEQCVRLSVQPNTVSVTMSEVQLSLQTQNVPSLSAGVNCSF
EDYVETEGRIYGGRIFCLSPSTKAVSPITRDQGDQRVIKLYLKSKETGKKFASVDFVFYN
CSVHQSCLSCVNGNFPCHWCKYRHMCTQDASDCSFQEGRVNTSEECPQILPSTQIYMPAG
VLRPITLLAQNLPQPQSGQRNYECIFHIQGNTHSVPALRFNSTSIQCQKTTYSSVGSECS
TLKPPDTSPVWMNGNILIDFSRTHRAHLYKCRALRDSCGMCLKADPRFECGWCVQDRKCS
LRQECNGGGNAHLPLQPQEGGGWMHATSGNSRCTHPKITKLFPETGPRQGGTRVTILGEN
LGLQFRDIQMGVRLGKVPCVPIEEEYISAERIVCLLNDATSYRVQEAQVEVCVRDCVNDY
RALSPRPFTFVTPFFSRIQPSQGPISGGTRVTIEGSYLNAGSYVSVSIGPQPCYFKKRFA
REIVCVTPAGLTAGTASVLVDIDDAELRNPEVKFNYTEDPTVLRIEPDWSIASGGTLLTV
SGTNLATIREPKIRAKYGQAESFHNCTVYNNSVMVCLAPSVADSELAFSESGTGPDEIGF
YMDNVNALVVVNETFSYYPDPVFEPLSASGVLELKPTSPLILKGRNLIPAAPGNSRLNYT
VLIGETPCVLTLSESQLLCEWPNLTGQHKVTIRAGGFEYSPGTLHIYSDSLLTLPAIIGI
GGGGGLLLLVIIAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHE
LTQELDGAGIPFLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKALTLFGQLLTKKHFLL
TFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIDRNLESKNHPKLL
LRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLS
EDKLIRQQIDYKTLNHCVHFPFLLFPTVCMFSSPQTLHCVNPENENAQEVTVKCLNCDTI
TQVKEKLLDAVYKGSPYSQRPKASDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLA
HYQVTDGSVIALVPKQNSAYNISNSSTFTKSLSRYVFPALESMLRTASSPDSLRSRTPMI
TPDLESGTKLWHLVKNHDHSDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFS
TAHRGSALPLAIKYMFDFLDEQADKHSITDYDVRHTWKSNCLPLRFWVNVIKNPQFVFDI
QKNSISDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKNWVERYYSDISRM
PAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYIIKYKDEV
Download sequence
Identical sequences G3NLW2
69293.ENSGACP00000006325 ENSGACP00000006325 ENSGACP00000006325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]