SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NLZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NLZ0
Domain Number 1 Region: 410-711
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.47e-76
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-30
Family Spermadhesin, CUB domain 0.0000391
Further Details:      
 
Domain Number 3 Region: 161-270
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-29
Family Spermadhesin, CUB domain 0.000029
Further Details:      
 
Domain Number 4 Region: 274-344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 108-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000829
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 6 Region: 341-404
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000195
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3NLZ0
Sequence length 712
Comment (tr|G3NLZ0|G3NLZ0_GASAC) Mannan-binding lectin serine peptidase 1 {ECO:0000313|Ensembl:ENSGACP00000006353} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MFGTLKSPDFPDPYPRDTVLRWNLSVPDGFRIKLYFSHFHLEPSYLCEYDYVKVEAEEEV
LALFCGGEETDTEAVPDQKIITSSRNSMSLLFSSDFSNEERYSGFMAHYSAVDVDECSER
TDEDLLCDHLCHNYIGGYYCSCRHGYLLHFDNHTCRVECSDGVFRERSGEFSSVDFPSPY
PKSSACSYRIEVDPGFKLLLQFDPRFEVEDHPDISCPYDHLKITTGSKEFGPFCGNQPPA
EIQTDSNVATVFFHSDNSGENLGWRITYTSTGSKCRAPEAPPNALLTPVQSEYSFKDHIV
VTCSPGFTLMKDGENLDYYQLECQSEGSWSSSPPQCQMVDCGSPKVVSMAHLVFGSDDNS
TKFGSSVEYVCREDFFQLNSSSSCGSTGEWQNSQSGSRPPTCVPGNLHSATGTPLSSLYS
VPPACGRPSRLPPPQVKRIVGGRRSEPGLFPWQVLLSVEDLSRVPEDRWFGSGALLSSSW
VLTAAHVLRSQRRDASVVPVAPEHVQVYLGLHDNTDKRLATNRTVEKIFLHPNFQPDNYN
NDIALLRLEEQVGFTEFIRPVCLPPPKRQGDPPSPLPNSMGVVAGWGISNLNTTSSSGDP
IKLTAKPGMTSDLLQYVKLPVVSQDECEGSYASRSVSYNITDNMFCAGFLEGGRDTCLGD
SGGAFVMEDMVSRRWVVFGLVSWGGPEDCGSQRVYGVYTRVANYVEWIQKQL
Download sequence
Identical sequences G3NLZ0
ENSGACP00000006353 ENSGACP00000006353 69293.ENSGACP00000006353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]