SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NMB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G3NMB8
Domain Number - Region: 68-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0587
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3NMB8
Sequence length 105
Comment (tr|G3NMB8|G3NMB8_GASAC) Si:ch211-240g9.1 {ECO:0000313|Ensembl:ENSGACP00000006481} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
VLCSSLLCSTGQLAVGTCEIVMLNRDSSVPRRTIARQTARCACRRGQIAGTTRARPACVD
ARIVRSRQWCEMAPCLEGEVCSYLFNRSGWTCTRGSGRIKTVTVI
Download sequence
Identical sequences G3NMB8
ENSGACP00000006481 ENSGACP00000006481 69293.ENSGACP00000006481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]