SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NMF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NMF8
Domain Number 1 Region: 25-136
Classification Level Classification E-value
Superfamily TPR-like 1.9e-30
Family Tetratricopeptide repeat (TPR) 0.0013
Further Details:      
 
Domain Number 2 Region: 183-257
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.09e-18
Family Canonical RBD 0.0053
Further Details:      
 
Weak hits

Sequence:  G3NMF8
Domain Number - Region: 131-171
Classification Level Classification E-value
Superfamily UBA-like 0.000281
Family UBA domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3NMF8
Sequence length 318
Comment (tr|G3NMF8|G3NMF8_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000006521} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
KEEKQKPNEERPIDPAAEESAQRSRELAAFGNRLAALGQYETAVQCFTDAIKYNPQESKL
FGNRSLCYERLQQYDNALSDADQALSMEPNWIKGLFRKGKALCGLKRYYEASLIYREVLK
LDASSGEAEQELKRAQTLHLMEMGFNWAQSSAALKTHATLEQAVEALFGEEGNPGRGGNR
PKKEIFSVWVGSLSPAITYSTLHELFSRAGTVHSIKMLLEQQCVFVNYTSVEDCDRAIQC
FNGMVVEGSPLSVRYPNKFRFGAFSSAASDPFPRLNLYKKECFFWRTVGCTRLDCTFRHV
PEHKNVDKDKFSGRNVNM
Download sequence
Identical sequences G3NMF8
ENSGACP00000006521 ENSGACP00000006521 69293.ENSGACP00000006521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]