SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NMX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NMX5
Domain Number 1 Region: 99-340
Classification Level Classification E-value
Superfamily vWA-like 8.71e-67
Family Integrin A (or I) domain 0.00000212
Further Details:      
 
Domain Number 2 Region: 1114-1295
Classification Level Classification E-value
Superfamily Fibronectin type III 1.22e-34
Family Fibronectin type III 0.0000322
Further Details:      
 
Domain Number 3 Region: 1508-1708
Classification Level Classification E-value
Superfamily Fibronectin type III 2.43e-33
Family Fibronectin type III 0.00083
Further Details:      
 
Domain Number 4 Region: 600-687
Classification Level Classification E-value
Superfamily Integrin beta tail domain 7.98e-16
Family Integrin beta tail domain 0.0028
Further Details:      
 
Domain Number 5 Region: 970-1086
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000017
Family CalX-beta domain 0.0025
Further Details:      
 
Domain Number 6 Region: 2-48
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000012
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 7 Region: 515-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Weak hits

Sequence:  G3NMX5
Domain Number - Region: 556-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000391
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Domain Number - Region: 799-881
Classification Level Classification E-value
Superfamily SEA domain 0.0876
Family SEA domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3NMX5
Sequence length 1802
Comment (tr|G3NMX5|G3NMX5_GASAC) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
NPCFAVRAGTCSECLQAWKDCAYCPEESFKGPRCDLYENIIAHGCSAAAALTAKSSMMIE
RKQPINMRLKQSQVSPQQVSMSLLPGEEKEVDVEVFAPTKGPLDLYILMDFSNSMVDDLN
NLKRMGTQLASLVKDLSDDYTIGFGKFVDKVVEPQTDMRPSKLKEPWPNSDPPFSFQNVI
KLTSDAAFFDSELQKEKISGNLDAPEGGFDAILQAAVCGDKIGWRDNSTHLLVFSTESSF
HYEGDGVNVLSGILARNDEGCHLDAAGKYTKDTQQDYPSIPTLVRLLGKHNIIPIFAVTD
HSYTYYEKLREYFPIAEIGRLQEDSSNILTLMRVAFESIRRKMSIRAEDKPKAFVTNFLD
TSGRVVEHGAFDFKPGAIGNFKMRLSAQQMVGGKPVCQLEPLGKKGSIRVKPTTFNAAAN
VDATILCPSCECEKSAIPAAAKCHGHGDLVCGRCQCYDGWLSTFCNCSESSAAQDTSRCL
GPDMKDPCSGRGDCLECGTCVCYNPDQFEGEYCQYDKTDCQRYGGFLCNDRGSCIRGRCA
CNEGWAGNACECPNSNATCLDSKGGVCNGRGECVCGRCKCPESDMSMTSTCAPNFEAQLG
VCEGTRSCVQCQAWKTGEKKDKTQCDKCPFKIVLVDELKEEKDVAHSCSFRDEEDDCTYR
YNVEDWKPDSKVKELQFQVLKKKDCPPASLLWLLPLLLFLLLLLALLLLCCWKYCACCKT
CLALLPCCKGGRMVGFKEDEYMFRQSLLTSDHLDTPMVRTGPPKGTDVVRWKVTDNVHRS
PTHPQVLMKPNPKEIIPFPISLRLNRLFSENLSRPDSRDAEQLRKEVADNLNEVYKQIPG
AQKVQKTLFRKQKNAGKRQDFAIMDTVLSAPRSSYPDIVKLTQKNVQSGNLHDLKVVPGY
YTVATDREAAGAIEFQEGVGSVDVHVPLFVKDEDDDKKQLQVEATDVPLGIAEIGKRFVN
ITIIKEHATGVFSFLQPAYTYSRGDGVAHIPISKEIIEEGSSQVTYRTRDITAKDKKDYV
AMEGDLTFGPEETQKIVPVRLLELSEKDGLLADKQVRQFAIDLSNPRQGAKLGRYPRTTV
TIADEPGEKTKPYISAPHPSRNPGAVKGGRLFSPTNLKAKATGPRNIRLNWDAGSGNPAG
YKVKYWYGDPEKDAQVLDVKSPQAELTDLYPYCDYEMRVCSYNALGDGSDTDIVTCQTLE
DAPGEPGRLAFNVISPTVTQVSWGEPAETNGNITAYEVIYTPIDDDLKAVGAAKKVKIDN
PKKRMLLIENLQRAQTYQYKVRAMNSIGWGPFKDASINLASQPTRPMSIPIIPDVPIVDA
EAGDEYDGYLMYSNEVLRTPTGSKTPSVSGDGGHLVSNGKWDQNFLFPGGSATRNLSSSS
SPMSYADYRCFSPHPPPNSLVSQLRSVCVTLPLSLLSLPTCPSLSLLPGPTSFTSRPSLP
ALCPPPLSLPLRNAHQVGSATLGRRAALEPVQLQPVWGPEGQTELTISTQNRSQKWFIPS
DARLSPGIPDTPSRLVFSALGPTALKVSWQEPRCDRDLQGYCVLYQLLNGGKMNTVNVTN
PAENSVIIQDLLPNQSYLFKVKAKSQEGWGPEREGVITIESAVDPKSPLSPMPGSPFTLS
TPSAPGPLVFTALSPDSLQLSWEKPRKPNGDILGYVVTCEQLHGGGDVRSFEVNGDTAET
SLTVPNLTENIPYKFKVQARTTQGFGPEREGIITIESQDGSSLSQYNSQSMSSREVFQMP
TEVSTRMNISHTMMDPYFSDGAMMTTQHMETSGMVTRQVTKEVVQRSVMGGTTVTKKMFY
ES
Download sequence
Identical sequences G3NMX5
69293.ENSGACP00000006688 ENSGACP00000006688 ENSGACP00000006688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]