SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NNT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NNT6
Domain Number 1 Region: 439-601
Classification Level Classification E-value
Superfamily Fibronectin type III 4.37e-17
Family Fibronectin type III 0.0000787
Further Details:      
 
Domain Number 2 Region: 346-434
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000326
Family Fibronectin type III 0.00097
Further Details:      
 
Weak hits

Sequence:  G3NNT6
Domain Number - Region: 322-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000174
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 290-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000265
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 135-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000486
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 604-648
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000642
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number - Region: 105-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000706
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 197-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000963
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 260-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00177
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 12-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00209
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 43-66
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00327
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 74-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00383
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 167-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 227-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0804
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3NNT6
Sequence length 649
Comment (tr|G3NNT6|G3NNT6_GASAC) Tenascin C {ECO:0000313|Ensembl:ENSGACP00000007000} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
DDCSIELCLLDCGDYGHCVDGSCLCEDGFIGEACDQTNCLNNCLGRGRCVDDECVCDEPW
TGFDCSELICPNDCYDRGRCVNGTCYCDEGYAGEDCGELTCPGNCNNRGMCVNGQCECQT
GYSGEDCSKLTCPKNCNERGHCFNGKCICDPGFEGEDCSVLSCPDNCSNRGQCIDGECVC
DVGYQGEDCGELSCPNNCQDRGRCVNGQCACDAGFAGEDCSVKTCPKACMGHGECVDGNC
VCFVGFAGEDCGELTCPNDCLDRGDCVSGQCVCHKGFTGEDCGEKTCPKNCLDRGYCVDG
DCVCYEGFTGPDCSIKTCPNDCQDQGRCESGVCVCNEGFIGEDCSVVSPPKDLTVVEVTP
EVVDLSWENEMRVTEYLITYVPTAQGGLELDARVPGDQKMTTIRELEPGVEYLISVYALL
NNKKSLPVSARVSTHLPEPEGLKFKSVRETSVQVQWDPLDIKFDGWNLIFRNTKEEDGEI
LNSLGRPETTFEQSGLGPGQEYEVKLEVVKNNKRGPPASQNVVTMIDAPSQVDVRDVTDT
TALATWSQPVAEVDGVSVSYGPSSNPADRTVVKLSSTETQYHLGGLTPDTQYEVSLLARR
GERTSIPVYESFLTDLDAPRDLQTVELTDETITLEWKNSRAPVENYRIK
Download sequence
Identical sequences G3NNT6
ENSGACP00000007000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]