SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NPX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NPX2
Domain Number 1 Region: 25-189
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-31
Family Laminin G-like module 0.0045
Further Details:      
 
Weak hits

Sequence:  G3NPX2
Domain Number - Region: 204-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000322
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3NPX2
Sequence length 236
Comment (tr|G3NPX2|G3NPX2_GASAC) Neurexin 1b {ECO:0000313|Ensembl:ENSGACP00000007387} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
LLMLLLLFFYSFSVCSFFLSSKIGTCLEFTGAEGQWARFPVWNACCESEMSFSMKTKSSN
GLLVYFDDEGFCDFLELLILNGKLSLRFSIFCAEPATVVSDTAVNDSQWHAVTIRRNFKN
TTLKVDNEKKWVEVKSKRRDMTVFSHLFVGGIPPELRSVALRLTSDAVKDQLPFTGWITD
IKVNNTEPVMIDGEGVLEDLCGSANMCLNGGVCSIINNEPTCNCSRTGFQGKDCSE
Download sequence
Identical sequences G3NPX2
ENSGACP00000007387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]