SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NQ94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NQ94
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily C-type lectin-like 5.25e-20
Family C-type lectin domain 0.0027
Further Details:      
 
Domain Number 2 Region: 204-333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000471
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 371-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000189
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 4 Region: 328-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.0086
Further Details:      
 
Weak hits

Sequence:  G3NQ94
Domain Number - Region: 399-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0113
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3NQ94
Sequence length 425
Comment (tr|G3NQ94|G3NQ94_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000007510} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
CTSNACFTLHMDKVRFNEASEYCSDNGGYLMTVKNQEEEGVLRSLLSQIQTHPLDEALWI
GLKLHSGNCVLADQSLRGFKWESGDQDSNYSNWEKEPLPTCTERCAMIHFTKSGQSQLKW
TDKHCKQTAFYACAFYFKGMCRPLALVGPGKITYTAPFSEEPLRSDMQLFPLATYAVISC
DDKPPHDQPSVCLAMDNTYRWHRPGPFCKTGKRYCETNNGGCEHLCRQDAEEVRCFCREG
YDLDEDGLACRLKAVCGVETCEHQCVITESGYSCRCPEGFELEVNQRNCSDVDECKSRAC
GDRLCLNTHGSYTCECRGGYRMVAGECVDIDECTHTGCEHSCSNSVGSFSCNCNEGFRYA
PNINHPEQCILHCAQQKCPAVCENDQCFCPEGFIRSGQYCEDIDECLNGCDHNCKNTFGS
FVCSC
Download sequence
Identical sequences G3NQ94
69293.ENSGACP00000007510 ENSGACP00000007510 ENSGACP00000007510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]