SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NRK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G3NRK9
Domain Number - Region: 188-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3NRK9
Sequence length 396
Comment (tr|G3NRK9|G3NRK9_GASAC) Chondroitin sulfate proteoglycan 5b {ECO:0000313|Ensembl:ENSGACP00000007976} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MSDDVITVEFHSPAPDIAPSDVALNWAKAPKAQKQKDGKPTEWTLSDFYDYPSPDDELSA
LDATPELEDTPSFPLEMEDENPLLAGAPAAPAAPAAPDASAAPAAPAAPAAPAAPAAPAA
PAAPAAPAAPAAPVAPANRRPNMDSGSFLPATLMPGMEIADGFGFAGAMGADGCRLGFVR
SGPGVCVSECDSQPNFCFNGGVCTVVAGMGAFCRCNVQDYIWNKGTRCDWAVTEFQVMCA
VVGVASLVVIFLFMIIVFFAKSLHRLKSENIRLRKRSKYRLQSSEPQTDGLSVSTTADGS
QPNVRKLCDTPPIAPQAHTHNLAYYDNIICQDDPQKQEYPAKPPQAKEEGSMNILNSHSP
KHENNRPTSVAHDHGHHTPNNTEENAEVNSLQNNLV
Download sequence
Identical sequences G3NRK9
ENSGACP00000007976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]