SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NT05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NT05
Domain Number 1 Region: 40-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000143
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number 2 Region: 199-243
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000837
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Weak hits

Sequence:  G3NT05
Domain Number - Region: 109-143
Classification Level Classification E-value
Superfamily FnI-like domain 0.0188
Family Fibronectin type I module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3NT05
Sequence length 345
Comment (tr|G3NT05|G3NT05_GASAC) WNT1 inducible signaling pathway protein 3 {ECO:0000313|Ensembl:ENSGACP00000008473} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
VNAPLPSPLLTQCFSWAQNNGQLAPRDRGAAAERRQFCQWPCKCRQRPHCAPGVSSVLDG
CGCCKSCARQIGDPCNERDVCDPHKSMYCDFSADKPRYEVGVCAYLMAVGCDLNGAHYEN
GEGFQPSPLYKCTCIAGAIGCTPAFIQKPVSLLSPAPLMGNLPAGLRSSLSPKKHRQDTT
YMGEGAFHYCGGVRTWKKNCLIQSTPWSPCTKTCGLGISVRVNNDNGKCEMRKDRRLCLL
RPCEKSVMRSVKVQKGKTCRPKFQAKKAEKLTLSGCTSTKKFKPMYCGVCTDKRCCVPNK
SSMIKVNFTCKAGSNTEWKMQWITSCVCQRKCNDPGDMFSDLRLL
Download sequence
Identical sequences G3NT05
ENSGACP00000008473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]