SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NT90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NT90
Domain Number 1 Region: 119-363
Classification Level Classification E-value
Superfamily vWA-like 2.09e-67
Family Integrin A (or I) domain 0.000000755
Further Details:      
 
Domain Number 2 Region: 382-454
Classification Level Classification E-value
Superfamily Integrin domains 1.41e-17
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 3 Region: 25-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000251
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 4 Region: 568-608
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Integrin beta EGF-like domains 0.0025
Further Details:      
 
Domain Number 5 Region: 611-692
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.000000798
Family Integrin beta tail domain 0.0044
Further Details:      
 
Domain Number 6 Region: 526-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Weak hits

Sequence:  G3NT90
Domain Number - Region: 488-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family Integrin beta EGF-like domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3NT90
Sequence length 723
Comment (tr|G3NT90|G3NT90_GASAC) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MTSWFRTYVRLLLCCVVVASDAGDSACWSPGVTSCAECLGRGPQCAWCFKKDFLVPSQRC
DSPVKLLRRGCDREFMEQSEIKVEVDATASSTQVSPQDISITLRPGSEASAIVAVKQLER
YPVDLYCLVDVSASMQENLDHLKTVGVALSFRMAEHSSDLWLGFGSFVDKPVSPYINVHS
SKIDNPCSDYEIRCRPAHGFHHVLSMTSNMSEFTRVIKRQRISGNMDTPEGGLDAMLQAA
VCQRSVGWRPDAKRLLLLMTDQPSHLALDSRLAGIVTPHDGLCHLENNVYTGSTKMDHPS
VGLLSDKLLENHMHSIFAVEKQQYQWYEELVRLLPGSYLGKLGFFQAPNLIELVVDAYKT
LLSEVAVSVSVEDKAASRYWVSVSPLCPDGSTVKDQSCSGVMPGQTVYFNITIGMRSCPG
NGEDEDVTVMVRPVGYNESTVIKVHSKCTCSCGATRRCYEESQCGGSSGQEQELDQGLIN
DADGESSWNCRRDGSDVDCSGRGACECGRCVCDQTRLGAVYGKHCEIDDFSCPYRGGLLC
GGRGTCVSGECVCEDDWTGDSCGCPVSTATCQSTKGLLCGGRGRCVCGRCVCDDPRRSGD
FCERCPACQNSCQSYWKCVDCHLSHGLAQKEAGHCNNTCAPLVGYVDVVSGQAEEMWIQC
MYISNDNCRHRFQTSTRAGQAQLQISTRPECGNNSRLLGTFLSVCALTVLCGLVVVAVSR
LLL
Download sequence
Identical sequences G3NT90
ENSGACP00000008558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]