SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NUU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NUU1
Domain Number 1 Region: 469-601
Classification Level Classification E-value
Superfamily TIMP-like 4.51e-37
Family Netrin-like domain (NTR/C345C module) 0.017
Further Details:      
 
Domain Number 2 Region: 285-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000001
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 3 Region: 341-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 4 Region: 404-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 99-177
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000312
Family APC10-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3NUU1
Sequence length 601
Comment (tr|G3NUU1|G3NUU1_GASAC) Netrin 1b {ECO:0000313|Ensembl:ENSGACP00000009110} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
TMQRILEVWVALVTVAALTEGVSGGYGLSMFAAQSSPPDPCYDENGNPRRCIPDFVNSAF
GKDVRASSTCGGPAARYCVVSEKAEERTRDCHTCDAADPKKSHPPAYLTDLNNPHNLTCW
QSENYAQYPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKSWVPFQYYSTQ
CKKMYNRQNKAAITKQNEQEAICTDSHTDMHPLTGGLIAFSTLDGRPSAHDFDNSPVLQD
WVTATDIKVIFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASKCVKDREG
NLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLS
GRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMTKSIAHRRACKACDCHPVGAAGKTCNQTT
GQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVASPTATYTSYEEPSDCESHCKASK
GKMKITMKKYCKKDYAVQVHVLKGDKAGEWWKFTVNIISVYKQGEHRIRRGDQLLWVRAK
DVACKCPKIKPGRKYLLLGTDDDSPGQGGVVADKGSLLIPWKDLWGRRLRKFQQRDKRGK
C
Download sequence
Identical sequences G3NUU1
ENSGACP00000009110 ENSGACP00000009110 69293.ENSGACP00000009110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]