SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NWY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NWY2
Domain Number 1 Region: 74-583
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.41e-193
Family Myeloperoxidase-like 0.000000000000152
Further Details:      
 
Domain Number 2 Region: 34-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000044
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3NWY2
Sequence length 620
Comment (tr|G3NWY2|G3NWY2_GASAC) Prostaglandin-endoperoxide synthase 2b {ECO:0000313|Ensembl:ENSGACP00000009851} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MEIKTSSNKVWNMNRFALAVFLLAIGFLVAEGGNPCCSEPCQNRGVCTALGADNYECDCT
RTGFHGHNCTTPEFLTWVKISLKPSPNTVHYILTHFKGFWNIVNNISFLRDAIMRYVLTS
RSHLIDSPPTYNADYGYKNWEAYSNLSYYTRTLPPVPEDCPTPMGVVGKKELPDAKLLAE
KLLMRRQFIPDPQGSSLMFAFFAQHFTHQFFKSDMKKGPAFTVAKGHGVDLSHVYGDSLE
RQHKLRLLKDGKLKYQILDGEVYPPTVKEVGAEMHYPPHVPDSHRFAVGHEAFGLVPGLM
MYATIWLREHNRVCDVLKEVHPDWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYNFKL
KFDPELLFNQRFQYQNRIASEFNTLYHWHPLMPDSFHIEEKDYSYKEFVFNTSLVPEHGI
GNLVESFTKQIAGRVAGGRNVPGPIMYVAIKSIENSRKMRYQSLNAYRKRFSMKPYSSFE
DITGEKEMAAILEEFYGHVDAVELYPGLLVEKPRTDAIFGETMVEMGAPFSLKGLMGNPI
CSPEYWKPSTFGGSVGFNIVNTASLQRLVCSNVQGPCPTAAFNVPDVKDTGSRIINSSNS
HSRGSDINPTVILKERNSEL
Download sequence
Identical sequences G3NWY2
ENSGACP00000009851 69293.ENSGACP00000009851 ENSGACP00000009851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]