SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3NXP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NXP2
Domain Number 1 Region: 2-212
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.19e-35
Family DNA gyrase/MutL, N-terminal domain 0.0005
Further Details:      
 
Domain Number 2 Region: 988-1180
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 1.7e-24
Family DNA mismatch repair protein MutL 0.0037
Further Details:      
 
Domain Number 3 Region: 195-349
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000531
Family DNA gyrase/MutL, second domain 0.008
Further Details:      
 
Weak hits

Sequence:  G3NXP2
Domain Number - Region: 807-835
Classification Level Classification E-value
Superfamily WW domain 0.0921
Family WW domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3NXP2
Sequence length 1213
Comment (tr|G3NXP2|G3NXP2_GASAC) MutL homolog 3 (E. coli) {ECO:0000313|Ensembl:ENSGACP00000010112} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MIKCLPEDVRGKLRSGVAIPSLQQCIEELILNSVDAEATCVGVRMDMDAFKVQVVDNGAG
MNAEDMERVGNRYHTSKCSTAEDLDNLRWYGFRGEALASVVSLATLVEISTRTRLSVKTH
VKIFKDGQGMGVFEAEAARPSSGTTVVVCDFLHNMPVRRKRMDAVLEGERIRHRVEAVSL
MHPSVSFTLKNDRTGAVMVQLPKATSTYHRFAQIHGLGRAQKLGEIRCTRGQFGVTGHVG
REGHYSNSLQFLYVNARLLQKTRIHKLLNFLLRRLSSSNPKSDSPHGPSVTRSPKHKRSQ
ELHAVYVVNIECPYSEYDICLEPAKTLIEFKDWDGILLCMEEAVKAFLSRENLVAVLRQD
DLDCEAPTMLCTRAADHGAHYTGNGGTGACRASSLDCAFGIKLASGAVYRKRKDGRVGED
GVGEECGQTRGREETKDPERQKGTEKEGGETHKEESLNKANRSEALYDHVRLKPPSDGTI
TVEEERSFIEAGEDPPVLPVSNSVGQPESEKLEPSKEKELLLSTNTSSISVIPLESIHQQ
TQPHSSKVEQIVPDCQSAGGHEHTLISNRRISLSHPFIHENLLTRDVAQINISVLQQQDS
AAKTEERPFASKRKISLYGGTCRKPSEEVIPKKILRVSSCQRLSLCKEPGSLEKFRRICG
PAGELKFPPQEKETRLPQIQRSHNWPVCQKDQRDGGVDATENEEMRSGRRRPPTSLAPAN
LKPVSGQSRAKLSLAAKLFYLTQHKTEKSNVSTHPPRATSQDGTRCRGDGVDNEEQCDAA
ANPEPVLGRCEDPLLAEEEEEDTASGDWLQHYDASVGKTVYINKTTGLSRYEGPAGEETR
ACCTSDVTNMAVSVVSEMGLEYRCYPFQVKLVLPFLPKSRTERVVSSGLDDRDVERTNSL
KSMYSKWNNPVFVCPSKVGVDISSGRADGLAVKIHNILFPYRFSKAMIHSMKACSSFGLD
QMFFLMVIHQVDKKFLACLIDTRDEESAALAESEGNLLVLVDQHAAHERVRLENLLADSY
EDDPEAPGERRLCSSTILPPLEISVTEEEQRLLRSCEAHLRSLGLEVKFSSAAKPQALVG
KVPLCFMEKESNEVRRGRPSVIKTIVKEYLQEQIELLRSTGRVRGSLPLTVLKVLASLAC
HGAIKFNDSLSRDECCSLVASLSSCQLPFQCAHGRPSIAPLVDTLHLDNEEKEIQKPNLQ
KLRRMYRSWELYG
Download sequence
Identical sequences G3NXP2
ENSGACP00000010112 ENSGACP00000010112 69293.ENSGACP00000010112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]