SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NZF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NZF0
Domain Number 1 Region: 41-107
Classification Level Classification E-value
Superfamily RuvA domain 2-like 8.15e-21
Family ComEA-like 0.021
Further Details:      
 
Domain Number 2 Region: 123-190
Classification Level Classification E-value
Superfamily RuvA domain 2-like 3.67e-19
Family Tex HhH-containing domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 255-537
Classification Level Classification E-value
Superfamily DNase I-like 0.0000000000000017
Family DNase I-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3NZF0
Sequence length 560
Comment (tr|G3NZF0|G3NZF0_GASAC) Endonuclease/exonuclease/phosphatase family domain containing 1 {ECO:0000313|Ensembl:ENSGACP00000010722} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
AAGAMGGSLGCHRSIPRDPTDFSCGKRKFSAACNFGHILVNQERLNINTATEEELMTLPG
VNRAVAQNIVEYRCCIDGFRKVEDLALVSGIGATKLEAIKLEICVSSRTSSSQHSPSSLR
KDPDHQSCSGMNINTATPAQLMSIRGITEKIAKNIVAYRAEHGAFRSIEDLVRVNHINSS
LLDKIRFQVFVERSRAPSTNTNAGLTCATKSHPSPTSCSLRSDDLDLPPGGPTQISSVRP
DAEPPCGLRDGKPVVRLATWSLQGCSCDKANNPGVKEVVCMTLLENDIKLLAVQDLLERE
ALDKFCVELNQGTLASVRKWKRPRGLWKSVVSEKPTGRSGKGVSYSGFLWDTLSGVDLKD
AAVLESPVANGNGNHTYPRLYLAHFSVGSYELSAANVHMQAAAASGESNGKSHNADEARC
PPLPPSIQETLKAEKELLVLGDFGCPAQSSELDILRKEKLCALVPSSQFTNISTRSPQGT
RCLDNIWVSRSLKKIYSGHCAVVREGLTNPWIPDNWSWGGVASDHCPVVAEFYADVSPKE
MRGPGVAVVDRGDVMPKHER
Download sequence
Identical sequences G3NZF0
69293.ENSGACP00000010722 ENSGACP00000010722 ENSGACP00000010722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]