SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3P0D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P0D5
Domain Number 1 Region: 15-331
Classification Level Classification E-value
Superfamily DNase I-like 7.32e-66
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3P0D5
Sequence length 440
Comment (tr|G3P0D5|G3P0D5_GASAC) Inositol polyphosphate-5-phosphatase Jb {ECO:0000313|Ensembl:ENSGACP00000011058} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
VSQLRCNIKKKQSVRFIRLHFITWNVGSATPPDDITSLLGLNVGDGNTDMYIIGLQEVNS
MINKRLKDVLFTDQWSEVCMERLSPFGYVLVTSQRMQGLLLLVFAKYFHLPFLRGVQTET
TRTGLGGYWGNKGGVSARMSAFGHTICFLNCHLPAHMENSGQRMEDFESILQQQQFEGQT
ATGVLDHDVVFWFGDLNFRIEDLEMQVVKTAIDTNKFPMLWEKDQLNMAKDSETVLEGFQ
EGPLKFPPTYKFDVGTDTYDTSSPSGKKRKPAWTDRILWRLRATAAAGAGKRGSTLGLTS
GTKVTQHYYRSHMEYTVSDHKPVSSIFTLQFPYKLDMPLVTIIVEDEWNSIDDAVAKFRL
APNYPRSSWDWIGLFKVGFKHHKDYVGYVWAKQEEADFTRQDHQVTFTEEELPKGSGDFI
LGYYSNNMSTIVGVTEPFQV
Download sequence
Identical sequences G3P0D5
69293.ENSGACP00000011058 ENSGACP00000011058 ENSGACP00000011058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]