SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3P2S2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P2S2
Domain Number 1 Region: 132-379
Classification Level Classification E-value
Superfamily vWA-like 1.78e-82
Family Integrin A (or I) domain 0.00000001
Further Details:      
 
Domain Number 2 Region: 375-464
Classification Level Classification E-value
Superfamily Integrin domains 1.94e-28
Family Integrin domains 0.0000209
Further Details:      
 
Domain Number 3 Region: 633-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000876
Family Integrin beta tail domain 0.00013
Further Details:      
 
Domain Number 4 Region: 24-82
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000136
Family Plexin repeat 0.0002
Further Details:      
 
Domain Number 5 Region: 547-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Domain Number 6 Region: 592-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000151
Family Integrin beta EGF-like domains 0.00081
Further Details:      
 
Weak hits

Sequence:  G3P2S2
Domain Number - Region: 510-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3P2S2
Sequence length 788
Comment (tr|G3P2S2|G3P2S2_GASAC) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MGNLLHRLVILFLFFLSASKVFGSNICTSQGVTTCRQCMAVHPRCAWCSKEEYGKGGSGA
SRCDYKENLLKGGCSPAAVEFPSSTLSIDKNAPLSDKASGQADDVTQIKPQKLGITLRPG
DSQRFTVSVKQAEDYPVDLYYLMDLSFSMKDDLARLRTLGSELADTMGHTTSKLRMGFGA
FVDKTTSPYMYTNPAEALENPCYGIHQKCQAQFGFKHVLSLTEKVARFTEEVEKQQVSRN
RDAPEGGFDAVMQAVVCKDRIGWRPDASHLLVFTTDAKTHIALDGRIAGIVQPNDGKCHL
DNENVYNKSTVLDYPSLALMTEKMSENNINLIFAVTDYVVPLYKEYSQLIPGTTVGTLSD
DSGNVIKLIVDAYAKIRSKVELELLGVPEELHLSFNATCLNEEVIPGLKSCSGLKIGDTV
SFSVEAQLRVCPKEKRHSFTIKPRGFKDSLEVTVDFACGCDCEADAKADSPLCSNGNGTY
ECGVCQCHPGRLGPRCECSVEDYSPSDDANCIPKPGAPICSGRGDCLCGQCSCHGNEFGQ
VWGKYCECDDFNCLRFKGALCSGEYHGKCSCGLCQCDAGWKGENCNCSTVVDTCMSSIGL
LCSGRGSCQCGVCQCTQPGAYGDTCEKCPTCPDACTIKKECVECQHFKRVSLVKQCVTQC
SHLLSPPGFHANAVNCSYKDENDCVVHFQYYEDGSGKSILDVVKEPVSRSPECPQGADIL
VVLLAVAGAILLLGLIGMLIWKLLVTIHDRREFVKFEEEKAKAKWDTANNPLYKEATSTF
TNVAYRGN
Download sequence
Identical sequences G3P2S2
ENSGACP00000011895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]