SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3P3Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P3Z5
Domain Number 1 Region: 994-1101
Classification Level Classification E-value
Superfamily PDZ domain-like 9.73e-26
Family PDZ domain 0.0000944
Further Details:      
 
Domain Number 2 Region: 1150-1252
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-24
Family PDZ domain 0.00012
Further Details:      
 
Domain Number 3 Region: 460-571
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-24
Family PDZ domain 0.0000258
Further Details:      
 
Domain Number 4 Region: 826-933
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-23
Family PDZ domain 0.00038
Further Details:      
 
Domain Number 5 Region: 645-749
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-21
Family PDZ domain 0.00025
Further Details:      
 
Domain Number 6 Region: 130-190
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.95e-16
Family Nucleotide and nucleoside kinases 0.0034
Further Details:      
 
Domain Number 7 Region: 312-350
Classification Level Classification E-value
Superfamily WW domain 0.00000000000282
Family WW domain 0.0013
Further Details:      
 
Domain Number 8 Region: 9-104
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000666
Family PDZ domain 0.026
Further Details:      
 
Domain Number 9 Region: 371-408
Classification Level Classification E-value
Superfamily WW domain 0.000000000195
Family WW domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3P3Z5
Sequence length 1273
Comment (tr|G3P3Z5|G3P3Z5_GASAC) Membrane associated guanylate kinase, WW and PDZ domain containing 1 {ECO:0000313|Ensembl:ENSGACP00000012318} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=MAGI1 OC=Gasterosteus.
Sequence
MSNPALKKNHWTSRVSECSVAKDARGELSVPLRGGAENGEFAHIGPVNEALVVFKSGKIY
EGELLLEVEKLPISGLPLYDVQTVIKNCKGPVRLKTVRQGSKLNKDLKHYLSQRFQKSSP
DHELQQTIRDNLYRHAVPCTTRGPRDGEVSGVDYNFLSVEDFLKLEKSGTLLEIGTFDGN
YYGTPKPPVQPPSGKVINSGGIGGDAPLPDGLSGSLPGSQHSTPRRRSKSYNDMHNAGIG
PGERQEDDDEDLPDMTSSFTGDSSELDEIPHSARPYAPRKSDPPYVGRTPSPSATTESTQ
QSNSHLSHPPPEDPLGILPDNWEMAYTESGEVYFIDHNTKTTSWIDPRCMDKPQKPLEEC
EDDEGVHTEELDNDLELPPGWEKIDDPVYGVYYVDHINRKTQYENPMLEAKRRRQLEQQQ
PQQQWMEDSALAGAPLASYAANHQETYRDPQKGPPMPNAMGQKRGKPFFTRNRSELKGTF
INTKLKKSRRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDICVLGY
THAQVVKIFQSIPIGSMVNLELCRGYPLPFDPDDPNTSLVTSVAIIDNKDPIIVNGQDGS
HNYDLPPSHGSQNNNIGSTNGGAPLNGLPRPHSPSADVASDTSSQHGYPSDVVTLASSIA
TQPELITVHMEKGDKGFGFTIADSPGGGGQRVKQIVDYPRCRGLKEGDIIVEVNKRNVQS
MSHNQVVDLLSKCPKGSEVTMLVQRGFTGVAPAKKSPKLEQLSRKDSQNSSQHSVSSHRS
IHTDSPLHSSLPLSESIAPPPPSQPLPGLPPQDPPADGTIQRKPDPFKIWAQSRSMYESR
LPDFQEQDIFLWRKDTGFGFRILGGNEPGEPIYIGHIVKYGAADEDGRLRSGDELICVDG
TPVVGKSHQLVVQLMQQAAKQGHVNLTVRRKTNYAVKAEGDVPPSPASSHHSSNQAPSLT
EEMGKRTPQGSQNSLNTVSSGSGSTSGIGPPNVASNAPSALQPYDVEIRRGESEGFGFVI
VSSVSRPETGTTFAGNACVAMPHKIGRIIEGSPADRCGKLKVGDRILAVNGCSITNKSHS
DIVNLIKEAGNTVTLRIIPGDESSNASLLTNAEKIATITTTHTSQQQAAPEASPRNTKPK
QESFEFKAPPGPPPQPPQQVSAQDAEFYSVDLERDNKGFGFSLRGGREYNMDLYVLRLAE
EGAAVRNGKMRVGDEILEINGESTKGMKHARAIELIKSGGRRAHLVLKRGDGSVPEYGGS
IYENIPFSPIFTP
Download sequence
Identical sequences G3P3Z5
ENSGACP00000012318 ENSGACP00000012318 69293.ENSGACP00000012318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]