SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3P432 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P432
Domain Number 1 Region: 82-328
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.96e-90
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 40-98
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000116
Family Hepsin, N-terminal domain 0.041
Further Details:      
 
Domain Number 3 Region: 4-42
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000144
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3P432
Sequence length 342
Comment (tr|G3P432|G3P432_GASAC) Transmembrane protease, serine 13a {ECO:0000313|Ensembl:ENSGACP00000012355} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
GLESCANGSLNCVTKYDTCTNNTVECDGINDCKLGSDEKYCVRFGEDNRLQVRTSEDGRF
LPVCFKDWDERYADLTCDQLGLNCGRQASTSRIIGGNVATVGDWPWQVSLRFRGSHTCGG
VLISPDFVLTAAHCFPRSNTFALLANNWKAYVGVVSLNDVLTSYSVERIILNENYDSNTN
DQDVALLKLASQVNYNDKILPACLPAYNQQFAPGTQCWTSGFGTTEAGSGIVSKELMEVA
VDIIDTKECNSSSVYGGAVTDHMLCAGDLKGGRDSCQGDSGGPLVCQNMNRWYLVGIISW
GSGCGNVNKPGVYTRVHSVLPWIYSNMQTRFMIVEVTFFSPE
Download sequence
Identical sequences G3P432
69293.ENSGACP00000012355 ENSGACP00000012355 ENSGACP00000012355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]