SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3P6T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P6T7
Domain Number 1 Region: 909-1100
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00048
Further Details:      
 
Domain Number 2 Region: 39-75
Classification Level Classification E-value
Superfamily WW domain 0.0000000237
Family WW domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3P6T7
Sequence length 1106
Comment (tr|G3P6T7|G3P6T7_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000013311} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
FVSFSSDWVEILEPRSRERMYVNLTTGECGWDPPSGVPVRQADGNQWWELFDAQSGRFYY
YNSTGRRTVWHRPQGADIVPLSQLQAMRRRGEHGTTGSVGSAGSQGRFTPLPERDRDGPG
APEPGHEAGEPEVDPAADSRSQGDGSSAENSTDGSKDQQRDASQRWQPAPGSKAAMLVKV
NSMSRSQPIPASQQQHLQHSAHGKPNTFTLHPNTIKPQGGLLNSTQGYKTAPSGKTATDP
RQAHHLRKASNGSFCLVTSDGSHPSPLLHRSQTSTPCPVSPHYGCTTPIYDEPVSECPIY
DEPPTDMEVEGAHLYNGHPLSRLTPTHSLQKPIQLQPPGSSHPGSRHRRNPSASDYSPAG
LECIKHMINVDPKQGLLSGSPVPTGTPSPTSRQDPVLLKDREPGTPGPSTLDKKQSWRVL
EATVQRAMEARHSRQSSQASQDFPSSTPQATANYQDSGYSTGLSPSLRRKSRRRVGAGGG
AGGRPGSVGSSGELSALNERLMAEMREVVSRSNTMREVRAGLDPEIGERVVAARTRSPAD
SLRWYAGGGSASRSASREELPGASRSLSRAGNHGNPALTPLEMPGRQKRTYEKVDTLEMS
VNSQASLSSPETPGPPSQEGTLELQAQLESRKKGMTDGRTASLGPHRPPTHDTSEGGDGA
GGRTRGSSYQLCYATLRQPPPPDTGMEDWASKHLNMHTQGLFRRRVSIANMLSWNRGSIK
KPMLVTSNRAVRKEACEMFKLVQAYMGDRPSRLDRRHCALLIVTKCWDMPGLRDELYVQL
VRQTTGNATPESLAAGWELMAVSMAFFAPSPKFRCYLEGYIQRHTEPVSDNKLTQFILEQ
QELKLKKNSKSRKKRKQNTDVEEALPISTYAKFCYRKLQKVAITGGKKGLRKPTLEEIDH
SRRAIVTPSLFGSSLEEVMERQSELFPDRKLPWVQVQLSQYVLALGGAQTEGIFRVPGDI
DEVNALKLQVDQWRIPENLSDPNVPASLMKLWYRELEEPLIPMNFYKQCVSNCDDPVAAI
AVVQSLPELNRLVLCYFIHFLQVFAQPSNVAITKMDVNNLAMVMAPNCLRCQSDDPRIIF
ENTRKEMSFLRMLIVHLETGFIEGVV
Download sequence
Identical sequences G3P6T7
69293.ENSGACP00000013311 ENSGACP00000013311 ENSGACP00000013311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]