SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3P7K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P7K1
Domain Number 1 Region: 396-678
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000915
Family Rhodopsin-like 0.03
Further Details:      
 
Domain Number 2 Region: 99-137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000164
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 3 Region: 4-134
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000298
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3P7K1
Sequence length 687
Comment (tr|G3P7K1|G3P7K1_GASAC) Si:ch211-241f5.3 {ECO:0000313|Ensembl:ENSGACP00000013575} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
DVDECAEDIKRCGKNATCHNTFGSFYCQCDVGFISTSQSLNFSAADNEDINECLQDKDIC
GPNAKCHNAIPHYSCSCLNGFYSTNGSKSFRGSKDITCQDIDECQNGNVCGQNATCDNTP
GSYQCVCNSGFRLKSGGFNFSGSQEQCEGEPSESTFNETKPPVSSALNCDAFKVLNHLQE
VTPHHKQLTIQQRLLSLIDELLSGGAFNDNRKVSTFLNLVENVLKLAAAFIEPPGTTRSS
THTELELLVKKGADLPKGAVTLSSKQAKLDLQLETAAGDSSYYPGFTTVYLLGYANLEDF
TKGFFGRMKPEANHRFELNSNVVTVSVSNRNTSHLEVPVKLTLYHLKQTNEFDHTCVFWD
ASEEGGSWSTQGCQVVESKAEYTVCSCNHLSSFAVLMALYDVEHTFELQLITWLGLSLSL
ICLFICILTFSLIQSLKSPRTTIHLHLCINLFIAFIIFLAGISRTENRVGCAVVAGLLHF
FFLAAFCWMCLEGIQLFRMVVLVFNTNFRTLYMLAGGYGVPAVIVAISALVNAKGYGTER
YCWLDLGFIWSFFGPVCVIITVNIFFFLITVWKLAEKFTSLNPDLDNLHKIKVFTITAVA
QLTLLGTMWIFGCFQFNEGTIVTSYLFTLCGSFQGVMLFVMHCLLSKQVRDEYGRILSRS
SAPWSKSYSNISNSHTSKAHRPSKSNI
Download sequence
Identical sequences G3P7K1
ENSGACP00000013575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]