SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3P945 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P945
Domain Number 1 Region: 244-323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-20
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 2 Region: 177-241
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000351
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 125-193
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000364
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 46-107
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000108
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3P945
Sequence length 333
Comment (tr|G3P945|G3P945_GASAC) Ntl-dependent gene 5 {ECO:0000313|Ensembl:ENSGACP00000014119} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
CPDRLLGEESRRTCPRPCKADRDCGNRRQCLCDGQCGLSCVAPGRTCPWPLPPSEDSEAR
LLSPTHSFSALLEVRCKPGFALPSGLDATIRRCQGDRRWSGEEPICTDPLPSEASGTRSP
ASTQSCPLPEDIVDTFSIQGDAAAGTSIRYTCLSGSDIVGSRENFCQDNQTWQYPHPICK
EVYCQPPREVQQGYVVAVQKTEYEVGFDIHYLCKKNFLLDGPQKVTCLSNGSWSASPPHC
RARCLIPAQRSRVVIGGVKRWPFDVTDTLVPHGEHVTFFCKHPRKQCSFSATQTCFDGRL
QTPACYLEPTWLQFKLPHRLVSEIEACGPDDVE
Download sequence
Identical sequences G3P945
69293.ENSGACP00000014119 ENSGACP00000014119 ENSGACP00000014119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]