SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3P9A9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P9A9
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily L domain-like 0.000000589
Family Ngr ectodomain-like 0.066
Further Details:      
 
Weak hits

Sequence:  G3P9A9
Domain Number - Region: 98-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00729
Family Merozoite surface protein 1 (MSP-1) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3P9A9
Sequence length 165
Comment (tr|G3P9A9|G3P9A9_GASAC) All-trans retinoic acid-induced differentiation factor {ECO:0000313|Ensembl:ENSGACP00000014183} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
IYGLPVLVMLDLSNCSLTHVEGLLGTSRAIMMIDLSLNPIVNISDAAFQGLIELDFIILP
EHVHCPGGNTSWAKVEVKGGNRLCEGQINWCNQTGQLSINCPENSLCAPYGPSFFECSCV
DDFHGYKCLRRGEFPGLLVFGPLGAVTVAASLLLWVTQRRKVKPL
Download sequence
Identical sequences G3P9A9
ENSGACP00000014183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]