SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PAB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PAB9
Domain Number 1 Region: 595-896
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-82
Family Protein kinases, catalytic subunit 0.0000000018
Further Details:      
 
Domain Number 2 Region: 2-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-71
Family Ephrin receptor ligand binding domain 0.00000141
Further Details:      
 
Domain Number 3 Region: 297-505
Classification Level Classification E-value
Superfamily Fibronectin type III 3.55e-42
Family Fibronectin type III 0.0000209
Further Details:      
 
Domain Number 4 Region: 890-965
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.49e-19
Family SAM (sterile alpha motif) domain 0.00023
Further Details:      
 
Weak hits

Sequence:  G3PAB9
Domain Number - Region: 228-297,335-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00706
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PAB9
Sequence length 968
Comment (tr|G3PAB9|G3PAB9_GASAC) Eph receptor A8 {ECO:0000313|Ensembl:ENSGACP00000014543} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
VNLLDTTTIAGDWGWLTYPSHGWDAINEMDEYFTPIHTYQVCNVMSPSQNNWLRTAWLPR
DGARRIYIEVKFTLRDCNSMPGVLGTCKETFNLYYYESDRAVGSAVRENQFIKIDTIAAD
ESFTGVDLGVRRLKLNTEVRGVGPLSRRGFYLAFQDIGACIALTSVRVYYKRCVGVSRNL
AVFTDVVTGADSSSLVEVRGQCVDHAEERDTPKMYCSAEGEWLVPIGRCVCSAGFEEHRD
SCVACEVGFYKPVAGDGLCGKCPQHSHSETRAALSCPCDSRYYRTADDPSAAPCSRPPSA
PVNAISSVNGTSVNLEWDLPLDTGGRSDLKYSVLCQKCSGDGGACEDCASSVRFVPRQSG
LTEPRVTVLNLVAHTNYSFRLLAMNAVTHLSMEPSPYALVNITTNQAAPSEVMAIRQENT
SQNSVILLWHEPNQPNGVILEYDIKYYEKDNEAHSYSTLKSRNTSARVSGLKPGTKYIFQ
VRARTSAGCGRFSQNVEIQTGKAAPLRYNTMTIIWICMALVSGLVTFMAIFICRKRHCGY
SKAFQDSDEEKMHYQNGHVHPSSIFHNSPMSFPDARFYIDPHTYEDPCQAVHEFAREIEA
SRIKIEKIIGSGEFGEVCYGRMRLPGKRDIPVALKTLKAGYTEKQKRDFLAEASIMAQFD
HPNVIRLEGVVTQSKPAMIITEYMENGSLDSFLRRHDGQFTIIQLVGLLRGIAAGMTYLS
DLGYIHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPDAAYTTSGGKIPIRWTAPEAIAY
RKFSSSSDVWSYGVVMWEVTSYGERPYWNLTNRDVIKSVEEGYRLPAPMGCPGPLHTLML
DCWQKDRNERPRFCQIVTVLDKLIRNPENLKSMDTLCSLSSPPLMDRAIPDFSSCNSVND
WLDTIKMSRYKDHFAAGGYQTLGHVVSMNQGDIQRLGVTLMGHQKKIMTSVQVMRAQVLN
KSVPSVHV
Download sequence
Identical sequences G3PAB9
ENSGACP00000014543 69293.ENSGACP00000014543 ENSGACP00000014543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]