SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PB10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PB10
Domain Number 1 Region: 349-484
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 244-395
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000251
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 54-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000287
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 133-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000698
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 207-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000215
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  G3PB10
Domain Number - Region: 470-513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000607
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PB10
Sequence length 633
Comment (tr|G3PB10|G3PB10_GASAC) Fibulin 2 {ECO:0000313|Ensembl:ENSGACP00000014784} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MFCDLKHSKGGARSLVLRDSLLTPLLPVSDGKFPNEAFSIGAADERANAVGDPEDVDECR
LLAGQLCQHTCTNVWGSYRCGCDRGYVLQRDGHSCAPVSPDEDNGVPEYGPAAVPTQGAL
AGGTTPGLDPCAENGPCGQRCAVAAGRARCSCFPGFSLKTDGHTCEDMDECATGAHGCRP
GEHCVNTVGSFACEQRVACPAGYRRRNGVCEDADECALRTHNCGTGFACQNTAGSFLCKP
RHKCISGFTQDSHGNCVDVDECSSLSEPCSSGFNCVNTVGSYTCQQKVIMCSHGHHVGPD
GARCVDIDECQVGTHRCGGGQICHNLPGSYRCDCQTGYQYDALRKACTDVNECWRHTGRL
CAQTCENTPGSYRCSCAAGFSLAADGKNCEDVNECDHSPCSQECANIQSSYQCYCRQGYF
LKEDGHTCEDIDECSQSIGNLCTFKCVNVAGSYQCACPPRGYVMSANGRTCKDLDECSAG
THNCSLGQNCYNLQGGFRCLSLDCPPNYKKVSDTRCERTSCPSSSLDCQKAPVRITHYQL
SFQTNIITPAQIFRIGPSPAYAGDHVVISVVKGNKEGYFGTRKLNGFTGAVYLQRQVRQP
KDFLIDVEMKLLRQGTVTSFLARIYVFITSSTM
Download sequence
Identical sequences G3PB10
ENSGACP00000014784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]