SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PC46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PC46
Domain Number 1 Region: 140-422
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.77e-42
Family Eukaryotic proteases 0.0000975
Further Details:      
 
Domain Number 2 Region: 53-105
Classification Level Classification E-value
Superfamily GLA-domain 2.47e-17
Family GLA-domain 0.00082
Further Details:      
 
Domain Number 3 Region: 95-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000115
Family EGF-type module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PC46
Sequence length 424
Comment (tr|G3PC46|G3PC46_GASAC) Protein Z, vitamin K-dependent plasma glycoprotein a {ECO:0000313|Ensembl:ENSGACP00000015170} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MRSCTTSAALLCLLAGAMAAVQTPHAVFLDKQQASSVISRQKRNVQPGAGQTSSLEQVCM
EKVCSYEEARKIFQDSYRTDIFWAVYIDGDQCAENPCKNGAMCSDSVGGYDCVCKSGFTG
VHCENDQTLCTWKNKTGCSQFCKPGYTSYECSCARGWKLSRTTRDKCEPAVPYPCGKVYS
LRQWNERVSSNVRSNFEGLSCSSSECPWQALLKAPESAGFCSGVILKENLVLTSAQCTKK
YKSFQVAVGKRSTNSEDGEQLYVKSVHVHPRFKDGHEYDLAVIELRDRITFKREVTAACL
PEKGFAERVLMSGELPAFVTGWKEPNQGSVFEGPLALNQLAYSHLPECLEAHPNLVTNKM
GCTAPQTNADCTMSSGSPLLTLYREVFFLTGVVSNPVGADCSKGYVFQKVSRYLGWLHAL
MGSR
Download sequence
Identical sequences G3PC46
ENSGACP00000015170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]