SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PD05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PD05
Domain Number 1 Region: 34-97
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000984
Family Ovomucoid domain III-like 0.005
Further Details:      
 
Domain Number 2 Region: 146-223
Classification Level Classification E-value
Superfamily EF-hand 0.000000000158
Family Calbindin D9K 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PD05
Sequence length 240
Comment (tr|G3PD05|G3PD05_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000015479} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MLTISVLLLPWLLSSPLVSSSPLAKVRSVCDRTFCGAGRECVSTDRGEPVCRCLQQCDVA
ENWVCGSNGRTYRNHCELHRDACTTQNKIHVQHRARCLEKPTETDVSPMACFLSHRDWLR
ESAMRWIQEEARSGDEASNVTTADALLQTYFKTYDDGDSELDSKEFLSFLKHNETTLNLT
YSSTLETNTLLRSLCVDALIELSDENADWKLSLTEFINCLTPTYHPYERSNQASPGFKLH
Download sequence
Identical sequences G3PD05
ENSGACP00000015479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]