SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PD42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PD42
Domain Number 1 Region: 880-932
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000144
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 2 Region: 4-42
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000968
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 641-699
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000667
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 4 Region: 699-756
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000128
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 818-877
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000602
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 6 Region: 580-639
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 7 Region: 760-815
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000732
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PD42
Sequence length 980
Comment (tr|G3PD42|G3PD42_GASAC) ADAMTS like 4 {ECO:0000313|Ensembl:ENSGACP00000015516} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=ADAMTSL4 OC=Gasterosteus.
Sequence
EAEPVEGVWSVWGEWSGCSQTCGVGVSQRSRTCFPPPPPLPYYPPRYPGPHRPYHSSSIS
DNHNQGVSLYRNTNPGGGGAPVPGQQRGTSMTHQPNATKTRRSSDIRPGQFGYGRVPFSL
PLHRPNRQARHTVNGTGAQTLPRQPPQLETRTATLATGRKPIRSTGGQESEPRLLTSSHA
LPRHLSYPTATGLTGTPSPRRLLPSLRSPAQTPRPSRHPFRIPSGAQAPRTEKVRPSPRG
RKQTRKHMRKPCPHHLPHSLSPLSLSILLSCIPPPCSLSSSLTSVHSFEVCEGGALESRA
EQCAAFDTQEFMGRLYNWEPFTEVGADKQCELTCRPSGYRFYVRQAERVTDGTPCFNVSS
NDVCVEGRCLTEGCDGALGSGAVIDKCGVCGGRESACRKVTGSFQNVTVPLGYHKILDIP
PGATFINITERRASPNYLAMRSGTGASVVNGRWAVDPPGEYQAAGTTFTYTRPRAQAQGE
EEQGESLGAPGPTTTQLQLYIIFHKENPGINYEFYVPETVLMSISFRPLSPRSSHRVHRT
VFSPPSSGRLTPERSRPRGSAPNRNARIPPRTDLPPDTQSPFVWRRGGLTECSASCGKGS
QNRVILCTNRHTDEEVPERKCDSAARPGPEEEPCNTHACPPFWEASSWSECSVSCGPGVQ
QRQLQCRQSFGNRSTMVHPQRCAHLTPPGSTQACQLGLCSHWEVGSAWSTCSVDCGVGRR
TRSVRCLSDQGSVVNEEECSSRARPQGSEECNMGPCVTNWYFTGWSNTCSAQCGPGVQRR
EVVCLTRGEVREGGGGGDCVGEKPAEMKACNGGPCVPTTMWYSSPWTQCNVACGSGSQRR
DIICVQKTGNDFTVAPAHECGHLEKPAAVQECEMGECEPLWFTTEWSACSRSCGKGLQMR
EVRCLAPDRKHSHECDLSTKPEQEQICNTIPCSPQVADENCRDRHPNCMVVVQARMCVYT
YYKTACCASCTQSAQRAKRH
Download sequence
Identical sequences G3PD42
ENSGACP00000015516 69293.ENSGACP00000015516 ENSGACP00000015516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]