SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PEA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PEA9
Domain Number 1 Region: 613-826
Classification Level Classification E-value
Superfamily GFP-like 7.53e-62
Family Domain G2 of nidogen-1 0.0024
Further Details:      
 
Domain Number 2 Region: 163-257
Classification Level Classification E-value
Superfamily Immunoglobulin 3.08e-22
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 78-171
Classification Level Classification E-value
Superfamily Immunoglobulin 1.64e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 3-81
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000244
Family I set domains 0.008
Further Details:      
 
Domain Number 5 Region: 555-605
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000732
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 6 Region: 1028-1152
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000132
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 7 Region: 936-1028
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000596
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 8 Region: 856-901
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000768
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 893-940
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000967
Family EGF-type module 0.014
Further Details:      
 
Domain Number 10 Region: 510-553
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000367
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PEA9
Sequence length 1266
Comment (tr|G3PEA9|G3PEA9_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000015933} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MRAVLSCETTGIPPPEVSWKRNGTPLDTSQQPAAYRLLSSGSLVLLTPSNEDEGYFECTA
VNDVGEERRVIEVILQEPPEIQPMAEEVQAVLHHGTVLPCEVRGFPRPSITWQREGVPIA
TGHRLAVLSNGALKFSRVTLGDAGSYQCLAKNEAGVAVGRTKLILHVPPVLSVPRVEYAA
VLGQPVGLECVADGQPQPQVTWHKERRPVVDGAHTHIFANGTLAISSAQRSDAGLYTCTA
KNLAGRASHDVRLVVQGKAIFMSYKEHGRLIRTCPSFKDSRRCCLAPLRVHRCPESPGRR
TVPPCPTFRANSPSCDPFLLPGAYRSLWISFLPTARGCRPVYLRGHQCSRLRETRHAPVH
QHEACVQRAAGRCDPEQRTASGLVLPRSGNPVPCHLLDCQQQPLLRAAPLCWTVRSAETP
SPCCAGFGMENRCSVRSECKRFATDPWSFTASLKANRISNGGRSLVRSLCVAVIAQPEDE
AFSQTDDRPSHEALQFLFWSFVIPSLENCSSWCQLSQTLLYRFDLQAADEGEYQCVAESE
AGTAERTFTLKVQISGGYSNWEEWGPCSSTCGQGLQKRIRLCNNPEPTNGGRPCSGPSID
SRKCQTGLCPGETPRRTRGSLIGMVNDREFGVSFLEVNVTDDPKEGSSTLHAHMDNIPPS
VGPLLRVLVSAFAPIYWSTVLQSGAARNGYSFTEGQFRQESQLEFETGEILRLTHVARGL
DSEGVLLIDIVINGFVPPLLSSSHLSLQAFDESYVQTGPGQLYSWSSQTHQRGGNPMVLR
CNHTIIYEGQEERQGPLLQLLKVSGMNSVYNMFTLTLDFHITSSLLIPDGYGDTCPKGFL
LDKAAYCADEDECALQSPCSHSCNNIMGGFSCACPSGFTISTETNKCQDIDECSQGSHMC
HYNQQCVNTVGTYRCQAKCGQGFKPSVTGTSCEDVDECQESALSPCQHQCLNTLGSFRCI
CHPGYQLSGHRCIDVNECTRNVCPAHKECRNTEGGYQCFDSCPAGMTKSENGACMDVDEC
QDGSHMCRYSQICQNTIGGYGCVCPRGYRSQGVGLPCLDVDECLLRKPCQHECRNTVGSF
QCVCPPGYQLLPNGRSCKDIDECADQGIQCGHNQMCFNTRGGYQCLDTPCPASYQSGRSP
GTCYRPCSLDCAAGGSPLLLQYKLLTLPSGIPANHNVVRLSAFSESGVLQQRTSFTVLEQ
EPVTGESGPVFGIRDEAGRGIIFTLRALNRAGLVRLKVQATTISLQGRITYQSIFIIYVS
ISTYPY
Download sequence
Identical sequences G3PEA9
69293.ENSGACP00000015933 ENSGACP00000015933 ENSGACP00000015933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]