SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PF30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PF30
Domain Number 1 Region: 604-894
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-79
Family Protein kinases, catalytic subunit 0.00000000235
Further Details:      
 
Domain Number 2 Region: 22-189
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-59
Family Ephrin receptor ligand binding domain 0.0000119
Further Details:      
 
Domain Number 3 Region: 311-515
Classification Level Classification E-value
Superfamily Fibronectin type III 1.45e-25
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 896-962
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.63e-17
Family SAM (sterile alpha motif) domain 0.00089
Further Details:      
 
Domain Number 5 Region: 240-304,351-364
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000785
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PF30
Sequence length 971
Comment (tr|G3PF30|G3PF30_GASAC) Eph receptor A2 a {ECO:0000313|Ensembl:ENSGACP00000016204} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
ATCFSMGGGLELTQPADLQSKEQVLLDMRASGSELGWLTLPYENGWEIVQTVVNGSLFYT
YSVCSIDSTEQDNWLRTTFIQRRPGATRVSVELRFIVRDCNTFDGASVACKETFNLFISE
ADADVGTNFRKGQFRKVATIAPDEVTRGRVLKVNTETRAVGPLSSKGFYLAFQDMGACVA
LLSVRVYYKTCPSTVQSLAAFPETVADALREVEGACVENSIGRATPRIYCTAEGEWVVPV
VQCQCLAGYEAAGDSCQVCKPGYFKASASSELCQVCPDNSKPSAAGATECQCEEDFFRSP
SDSPTSPCSAPPSAPRDLTSTSLSAQGRLQLSWSPPLVTGGRSDLTYSVACEHCDEASCV
PCGENIRFEPGATDLQDSTVVVGDLDSHLNYTFIVEAHNGVSQFGTDRPIASITTALDYT
DPPKVTLIHLDDRSPTSLSLSWTLSRRPPAHINHRYELMYRRKDGDGERDVTTYTVLILE
KSSVQINDLTPDTTYMFRVQALSPEGNPGTYSVEHDFLTSPLAESQIQNNSTMVMGAVAG
VALILLVVVAVLLLRRRRMNSRGRGGAEDPYFSSDQLKPLKTYVDPHMYEDPNIAIQKFV
TEIDATAISKQKVIGVGEFGEVFWGVMKTPKRGEVAVAIKTLKPGYSEKQRQDFLSEASI
MGQFSHPNIIRLEGVVTKFKHAMIVTEYMENGALDTYLKDRDGEIPSYQLAGMLRGIAAG
MKYLSDMNYVHRDLAARNVLVNSLLECKVSDFGLSRVLEDDAEGTYTTRGGKIPIRWTSP
EAIAYRKFTSASDVWSFGIVMWEVMAFGERPYWDMSNHEVMKAINEAFRLPAPMDCPSAV
YQLMLQCWQHDRSKRPRFTDIVNILDKLLRSPESLKTIADFDPRVSIRLPSSSGCDGTVF
RSVPEWLESIKMNQYKESFARAGITTMEQVLALRHEDIRNIGVRLPGHMKRIAYSILGLK
DETSSLSVFAV
Download sequence
Identical sequences G3PF30
69293.ENSGACP00000016204 ENSGACP00000016204 ENSGACP00000016204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]