SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PF31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PF31
Domain Number 1 Region: 193-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000401
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 2 Region: 154-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000102
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 121-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000402
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  G3PF31
Domain Number - Region: 84-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0567
Family Laminin-type module 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PF31
Sequence length 340
Comment (tr|G3PF31|G3PF31_GASAC) Delta-like 2 homolog (Drosophila) {ECO:0000313|Ensembl:ENSGACP00000016205} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
LPAQVLCIEPALVLCIEPAQAGSDCSCNVTNSSCDESGACRCDPGWGGERCERCRRPGCL
HGSCQQPWQCSCEPRLGGAFLRMGAACVMEDSGRLHLCVCPRGSTAEDCQLKTGPCYLRR
SPCKNGGLCEDGNGFAEDLSCRCLAGFTGRRCETDMDDCLMRPCANGATCVDGTNHFSCI
CPAGFTGRFCTVNLDDCASRPCLHAGRCLDGAGGFHCVCRPGYTGATCETEEGGRNASRH
GDSPFRVTVSERSAAGLSDVQLIVLLVLAGVTLAVVVLTGTVVLHGHCRARGTAPCCPLT
SSQQPAPQDECECHISFLNVAVTEKKKLNSEEVAGHTGLM
Download sequence
Identical sequences G3PF31
ENSGACP00000016205 ENSGACP00000016205 69293.ENSGACP00000016205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]