SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PFC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PFC4
Domain Number 1 Region: 36-96
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000148
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PFC4
Sequence length 223
Comment (tr|G3PFC4|G3PFC4_GASAC) Zgc:152863 {ECO:0000313|Ensembl:ENSGACP00000016298} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MSASAPCPSPCGRVTLVCGLLLLASSPLLTAGRLSNCTHPLVLEHGGFRCDPSPCRGFPL
KSSIHFFCEPGYHINNKVRVSRCRHGRWQPPIPACIPNREGPNMRSDDRVNNSMPSMATT
AVGVSIFLLTTTACLVVKSRLIPCQSHSRRSSDQLDLMVDGLPVSLPSYEEAMYSSWGQR
LPAFSAPGGPTQLLLAQEAPSCHPAALNNQDSSNRPPLPSPDN
Download sequence
Identical sequences G3PFC4
69293.ENSGACP00000016298 ENSGACP00000016298 ENSGACP00000016298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]