SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PGI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G3PGI3
Domain Number - Region: 17-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00709
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PGI3
Sequence length 205
Comment (tr|G3PGI3|G3PGI3_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000016707} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MGGCRVGFQMVNRSCRSPCDMLPNYCFNGGQCYLMEGTGVFCRCNVQDYIWHKGARCDSV
ATEFQVMCLAVGASALVVLLLFMIIVCFAKKLHVLKTENKKLRKRSKYRPSSEQHNDNFS
LSTIAEGSHPNKTMSRYTWECKTKEESDCEDDPNSQNKLEDPVKAAPKEDDSLNIHNSLT
PKHENHKVLGEENSSEVNSLQNNMM
Download sequence
Identical sequences G3PGI3
ENSGACP00000016707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]