SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PH87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PH87
Domain Number 1 Region: 557-848
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.35e-72
Family Protein kinases, catalytic subunit 0.000000253
Further Details:      
 
Domain Number 2 Region: 2-104
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000076
Family MAM domain 0.083
Further Details:      
 
Weak hits

Sequence:  G3PH87
Domain Number - Region: 451-485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000912
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PH87
Sequence length 1037
Comment (tr|G3PH87|G3PH87_GASAC) Tyrosine-protein kinase receptor {ECO:0000256|RuleBase:RU000312} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
AAILRSPLFPPPLRNSPCTVRFWLCSGGLQQRSLSLWIASNGTGAKEQRRLWHLVSKPVS
EYGWKVVRIPLYGLADWFWLQFSAEDGPGPGSAITIDNISFSMDCFLAFIIRLEDFIWTD
RQDHAPVHRKSFDEPPQHRFLDGGSSNSQTESASPRVKKWTFHTCGAVGPEGPTPTQCLN
SYRKSNVNVTVGTRGPFKGIQMWQIPKTGSYRVTAYGAAGGRSVLAMSRSHGVCITGDFL
LRRGELLYILVGQQGEDACPNSNGMLNRICLEQSGPMVNKTQVKGGGGGGGGATYVFKVD
KGVYIPLIIAAGGGGRGYSSLSETQLEQMDYDPSQPGRSGKSNAAGGGGGWNDRTPVSQG
GRPLVLGGQGGQACQKFWQTRGGFGGGGGGCMSGGAGGGYRGGNTSVDNNPKHDGDDGTS
FLGPEGQPFLYPLKAVEGDGEVVISPVQNCSHCESDECHETKGGIVCYCDEDLVLDPNGV
SCINATVVSSLHPQPTLSHLALGLSVGTSALIAALLLTVSGVMIMYRRKHTELQSIQLEL
QSPDCKLSKLRASTIMTDYNPNYCFAGKTASVNDLKEVPRRNISLTRGLGHGAFGEVYEG
LAVAIPGEPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFSHQNIVRCVGVSLQAMPRF
ILLELMTGGDLKSFLRETRPRLEHPSSLTMVDLLNVARDIAKGCQYLEENQFIHRDIAAR
NCLLTCKGPGRVAKIGDFGMARDIYRASYYRKGGRAMLPVKWMPPEAFMEGIFTSKTDTW
SFGVLLWEIFSLGYMPYPSRSNQEVLEFVTNGGRMDPPKNCPGPVYRIMTQSWQHQPEDR
PNFSTILERIDYCLQDPDVVTMPLPEEYGPIPEEEERVPMRPEDSSEPTVQLNAQFCNGC
SPPPHPIYLMTAARATPHSIPRGHTSPLSPGPEGGHITLAFTQGHVPERDAHNREKTSLW
NPTYGSWFLQQRKQQQRQGGVGGVCRPLLPPPPPPAAQSPLLLDSATLPPVPLYRLRRFP
CGNIGYGYQEQGLQLEA
Download sequence
Identical sequences G3PH87
69293.ENSGACP00000016962 ENSGACP00000016962 ENSGACP00000016962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]