SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PJB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PJB3
Domain Number 1 Region: 177-586
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.41e-78
Family L-arabinose binding protein-like 0.0019
Further Details:      
 
Domain Number 2 Region: 113-167
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000653
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 63-110
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000764
Family Complement control module/SCR domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PJB3
Sequence length 970
Comment (tr|G3PJB3|G3PJB3_GASAC) Gamma-aminobutyric acid type B receptor subunit 1 {ECO:0000313|Ensembl:ENSGACP00000017692} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=GABBR1 OC=Gasterosteus.
Sequence
MARILFLIILHGLPSLVVPIHNSSTGDSSSTVLFSVGCAIIRPPRDGGIRYRGLTQEQIR
SVQILPVDYEIEYICRGNRVIVGPKVRKCLPNGTWTDITLNSTCLLLCPRVWTSLENGRV
TVKPPGPPVEGTVLHYSCHAGFILEGRNISHCTKLGKWDAPKPTCLFNTFTHKSKKKLYI
GALFPMSGGWHGGQACMPSAQMALDLVNNRSDILPDYELELIHYDSMCDPGEATKLLYDL
LYTEPIKIVLLPGCSGVSTLVAEAARMWNLIVTSRGSRSPALSKRQRFPTFFRTHPSATL
HKPPRVQLFQKWKWTRIATIQQNTEVFTSTLDDLEERTKEAGIEISVRQSFLTDPAVAVK
NLKRQDARIIVGLFYETEARKVFCEVFKEKLYGKKYVWFLIGWYADNWFKIKDPAINCTV
ENMTEAVEGHVTTEIVMLNPETVRGVSNMTSQEFIAALMSRLGGKNPEETGGFQEAPLAY
DAVWALALALNKTVAPLKAKGRRLEDFNYNNHDITSEIYRALNTSSFEGVSGQVVFDAQG
SRMAMTLIEQLQGGSYKKIGYYDSSQKNLSWFGNDVWIGAGPPADRTVVIEVYRFLSQKL
FAAVSVFAGLGILFGIVCLTFNIYNGNVRYIQNSQPYLNNMTAVGCMMALAAVFPLGIDG
HHVHRSQFPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTLFTKKDEKKEYRQHLEPWKLY
ATVGVLLAIDFLSLMIWQIVDPLHITVEKFTKEAPKEDLDVLIQPLLEHCSSEKMNTWLG
VVYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQD
ASFAFAALAVVFSAYITLVVLFVPKMRRLITRGEWQSEQQDTLKTGSSTNNNDEEKSRQL
ERENRELQKIIQEKEERVSALRNQLAERQALRNRRQPSSGQNQNHNTPPPSTQPPDPNHC
HNSQIPLLYK
Download sequence
Identical sequences G3PJB3
69293.ENSGACP00000017692 ENSGACP00000017692 ENSGACP00000017692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]