SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PK87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PK87
Domain Number 1 Region: 11-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.95e-67
Family Ankyrin repeat 0.0000108
Further Details:      
 
Domain Number 2 Region: 655-963
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.82e-52
Family Ankyrin repeat 0.0000745
Further Details:      
 
Domain Number 3 Region: 1061-1096
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000051
Family SOCS box-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PK87
Sequence length 1107
Comment (tr|G3PK87|G3PK87_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000018017} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
QLSPLQSLIINGDAAALMALVRQSFGGLMEPDNEGWIALHEASFYGQLQCLAILIKAYPD
SVNRCTLKSQTALLLAAGRGNVSCVDFLLKNGASPNIFNKERETPLFAACENPSEDIVAL
LLRSGAQVNRCSLQGTSALHEACRHGQLKLCRLLLEAGGDLRIKNIYGIQSFFIAAQHGH
TDIIKLLAGEGADINEQAGDGASPLFEACKNGHVCGVNALLILKADANLSMKSGLLPLHV
AIQKKHSRIVSLLIPVTSRVRIQHSGISPLHIAAENNSDDIMELLIKSGFDVNSKLSEDR
SKMYKDRRSTPLYFSVYNGNLQATKMLLEAGADPNLDVFNALLIAVQLGRMDMAVLLLKY
GANVNAQISPQLSWFPAALLLKIESLPMFKLLLDNGCDAQPCFNCPYGQKSHPALSPALR
PIEEMRHSREAPPPSCLHFCEAVSSSSFCLAAGPIISLLLDYVSHVCLCSRLLEVLESRS
DWVDIRLKAQTCMKRHSSTMSANISRSEALEDYSLYSNLNDEELLQLAIERSLTDTPYNT
CDRMTSKTAYKTPPQPNSSSLNPEARARNPSRHSSQNPHANYSSHNATSAQATANYSSPN
PPREELPDLYVMTVSHFMTGSGKRMVEYRRTDGSLVVIAPEPEFKILRGQVIGLLSAACE
RNIPAMVAALLNHGAVVNSPCIWGCTALHEASGQNNVEICEMLLKAGAKHNLTNMYGISP
LFNAAQSGQLAALRVLLKHGADINSQAADGATALYEAAKNGHEEIVEFLLSQNANANIPG
KTGLLPLHVAAQRGSDIGKRLFRFNGCREPCYYTYTIVSMLISATSKTRVRRTGISPLHL
AAERNHDDVVELAIEAGFNVNSQLSEERSRLYQDRRSTALYFSVINNNIHAVHMLLEAGA
NPNVDLFRPLLVAARQGCIQIVTLLVEHGADINASLPTHPTTFPAVYMFSMKNLPMFKFL
LDHGGPALSCFNCIYGIRPHPSIKTTRTVRDLSETDSVPQQRGSVQFCEMISAAGIHRWA
GPIIDVLLDYVGHVTLCSRMIYHLDSYSDWSNIKEKATPPRPLLQLCRVQILQLVGQRCL
KKLPLPGGLIRFLQHQEGSVEDCLQET
Download sequence
Identical sequences G3PK87
ENSGACP00000018017 ENSGACP00000018017 69293.ENSGACP00000018017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]